This inventor holds 6 USPTO granted patents and 3 published patent applications and 2 EPO patents. Top assignees: Hangzhou Huibo Science and Technology Co., Ltd, Zhejiang University, Hangzhou Huibo Science and Technology Co., Ltd. Active years: 2015-2026.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile
Company Filing History:
2 out of 2 
2 out of 1,280 
1 out of 1 Years Active: 2015-2026
Title: Innovations and Contributions of Inventor Gang Wu
Introduction
Gang Wu is a notable inventor based in Hangzhou, China. He has made significant contributions to the fields of biotechnology and renewable energy. With a total of 6 patents, his work reflects a commitment to advancing technology for practical applications.
Latest Patents
One of Gang Wu's latest patents is titled "Cyclic peptide from novel bone morphogenetic protein 2, preparation method therefor and application thereof." This patent focuses on a cyclic peptide derived from bone morphogenetic protein 2 (BrvIP2). The cyclic peptide is characterized by specific sequences, including a cyclic polypeptide with the sequence CKIPKASSVPTELSAISMLYLGPGGDWIVAC (SEQ ID NO:1) or a variant with 80% homology to this sequence. The preparation method and its application aim to promote the repair of large-sized bone defects through composite materials.
Another significant patent is for an "Inverted thick 2D hybrid perovskite solar cell insensitive to film thickness and method for preparing the same." This innovation presents a solar cell that utilizes a 2D hybrid perovskite thick-film material as a light absorption layer. The material's thickness ranges from 500-800 nm, allowing for optimal sunlight absorption. The solar cell demonstrates efficiency stability with fluctuations of less than 5% across this thickness range, showcasing its potential for high-performance applications in renewable energy.
Career Highlights
Gang Wu has worked with prominent institutions, including Zhejiang University and Hangzhou Huibo Science and Technology Co., Ltd. His experience in these organizations has contributed to his expertise in developing innovative technologies.
Collaborations
Gang Wu has collaborated with notable colleagues, including Hongzheng Chen and Yi Liu. Their joint efforts have likely enhanced the quality and impact of their research and innovations.
Conclusion
Gang Wu's contributions to the fields of biotechnology and renewable energy through his patents demonstrate his innovative spirit and dedication to advancing technology. His work continues to influence the development of solutions for pressing challenges in these areas.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile