The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.

The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.

Date of Patent:
Jan. 07, 2025

Filed:

Apr. 15, 2021
Applicant:

Hangzhou Huibo Science and Technology Co., Ltd, Hangzhou, CN;

Inventors:

Yi Liu, Hangzhou, CN;

Zhen Lin, Hangzhou, CN;

Gang Wu, Hangzhou, CN;

Attorney:
Primary Examiner:
Int. Cl.
CPC ...
A61K 38/12 (2006.01); A61K 38/18 (2006.01); A61P 19/08 (2006.01); C07K 1/107 (2006.01); C07K 1/16 (2006.01); C07K 14/51 (2006.01); A61K 38/00 (2006.01);
U.S. Cl.
CPC ...
C07K 14/51 (2013.01); A61K 38/12 (2013.01); A61K 38/1875 (2013.01); A61P 19/08 (2018.01); C07K 1/1075 (2013.01); C07K 1/16 (2013.01); A61K 38/00 (2013.01);
Abstract

A cyclic peptide from a bone morphogenetic protein 2 (BrvIP2). The cyclic peptide from the novel BMP2 is selected from one of the following cyclic polypeptides: 1. a cyclic polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC (SEQ ID NO:1); and 2. a cyclic polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. A preparation method for the cyclic peptide from the novel Blv1P2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.


Find Patent Forward Citations

Loading…