This inventor holds 1 USPTO granted patent. Top assignee: Hangzhou Huibo Science and Technology Co., Ltd. Active years: 2025.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile
Company Filing History:
Years Active: 2025
Title: Zhen Lin: Innovator in Bone Morphogenetic Protein Research
Introduction
Zhen Lin is a prominent inventor based in Hangzhou, China. He has made significant contributions to the field of biomedical research, particularly in the development of cyclic peptides derived from bone morphogenetic proteins. His work focuses on innovative solutions for promoting bone repair and regeneration.
Latest Patents
Zhen Lin holds a patent for a cyclic peptide from a novel bone morphogenetic protein 2, known as BrvIP2. The patent details a preparation method for this cyclic peptide and its application in creating composite materials aimed at repairing large-sized bone defects. The cyclic peptide is characterized by specific sequences, including one with the sequence CKIPKASSVPTELSAISMLYLGPGGDWIVAC (SEQ ID NO:1), and variants with 80% homology to this sequence.
Career Highlights
Zhen Lin is associated with Hangzhou Huibo Science and Technology Co., Ltd., where he continues to advance his research and development efforts. His innovative work has positioned him as a key figure in the field of regenerative medicine.
Collaborations
Zhen Lin collaborates with notable colleagues, including Yi Liu and Gang Wu, to further enhance the impact of their research in the scientific community.
Conclusion
Zhen Lin's contributions to the field of bone morphogenetic proteins and his innovative patent demonstrate his commitment to advancing medical science. His work holds promise for improving treatments for bone defects and enhancing patient outcomes.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile