Vienna, Austria

Mathias Gebhart


 

Average Co-Inventor Count = 6.0

ph-index = 1


Company Filing History:


Years Active: 2015

Loading Chart...
Loading Chart...
1 patent (USPTO):Explore Patents

Title: The Innovations of Mathias Gebhart

Introduction

Mathias Gebhart is a notable inventor based in Vienna, Austria. He has made significant contributions to the field of biotechnology, particularly in the development of peptides. His work has led to advancements that may have important implications for medical research and treatment.

Latest Patents

Mathias Gebhart holds a patent for CETP fragments. This invention relates to a peptide consisting of 6 to 20 amino acid residues derived from the amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23). The peptide comprises the amino acid sequence WWLGID (SEQ ID No. 24) and includes antibodies that bind to these peptides. This innovation showcases his expertise in peptide design and its potential applications.

Career Highlights

Mathias is currently employed at Affiris AG, a company known for its innovative approaches in the field of immunotherapy. His role at Affiris AG allows him to collaborate with other talented professionals and contribute to groundbreaking research.

Collaborations

Some of his coworkers include Sylvia Brunner and Erika Bilcikova, who work alongside him in advancing the company's research initiatives. Their combined efforts contribute to the innovative environment at Affiris AG.

Conclusion

Mathias Gebhart's work exemplifies the spirit of innovation in biotechnology. His patent on CETP fragments highlights his contributions to the field and underscores the importance of collaboration in scientific research.

This text is generated by artificial intelligence and may not be accurate.
Please report any incorrect information to support@idiyas.com
Loading…