This inventor holds 1 USPTO granted patent and 1 EPO patent. Top assignee: Affiris Ag. Active years: 2015.
Company Filing History:
Years Active: 2015
Title: The Innovations of Mathias Gebhart
Introduction
Mathias Gebhart is a notable inventor based in Vienna, Austria. He has made significant contributions to the field of biotechnology, particularly in the development of peptides. His work has led to advancements that may have important implications for medical research and treatment.
Latest Patents
Mathias Gebhart holds a patent for CETP fragments. This invention relates to a peptide consisting of 6 to 20 amino acid residues derived from the amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23). The peptide comprises the amino acid sequence WWLGID (SEQ ID No. 24) and includes antibodies that bind to these peptides. This innovation showcases his expertise in peptide design and its potential applications.
Career Highlights
Mathias is currently employed at Affiris AG, a company known for its innovative approaches in the field of immunotherapy. His role at Affiris AG allows him to collaborate with other talented professionals and contribute to groundbreaking research.
Collaborations
Some of his coworkers include Sylvia Brunner and Erika Bilcikova, who work alongside him in advancing the company's research initiatives. Their combined efforts contribute to the innovative environment at Affiris AG.
Conclusion
Mathias Gebhart's work exemplifies the spirit of innovation in biotechnology. His patent on CETP fragments highlights his contributions to the field and underscores the importance of collaboration in scientific research.
