The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Jul. 21, 2015
Filed:
Jun. 11, 2012
Applicants:
Sylvia Brunner, Vienna, AT;
Mathias Gebhart, Vienna, AT;
Erika Bilcikova, Bratislava, SK;
Claudia Juno, Vienna, AT;
Pola Linzmayer-hirt, Wiener Neudorf, AT;
Birgit Schuh, Vienna, AT;
Inventors:
Sylvia Brunner, Vienna, AT;
Mathias Gebhart, Vienna, AT;
Erika Bilcikova, Bratislava, SK;
Claudia Juno, Vienna, AT;
Pola Linzmayer-Hirt, Wiener Neudorf, AT;
Birgit Schuh, Vienna, AT;
Assignee:
AFFIRIS AG, Vienna, AT;
Primary Examiner:
Int. Cl.
CPC ...
C07K 9/00 (2006.01); C07K 14/47 (2006.01); C07K 16/18 (2006.01); A61K 39/00 (2006.01); A61K 38/08 (2006.01); A61K 38/04 (2006.01); A61P 9/10 (2006.01); A61K 38/00 (2006.01);
U.S. Cl.
CPC ...
C07K 14/47 (2013.01); A61K 39/0005 (2013.01); C07K 9/00 (2013.01); C07K 16/18 (2013.01); A61K 38/00 (2013.01); A61K 38/04 (2013.01); A61K 38/08 (2013.01); A61K 2039/6081 (2013.01); C07K 2317/76 (2013.01);
Abstract
The present invention relates to a peptide consisting of 6 to 20 amino acid residues and being derived from amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID No. 23), wherein said peptide comprises amino acid sequence WWLGID (SEQ ID No. 24) and antibodies binding to these peptides.