Company Filing History:
Years Active: 1991
Title: Innovations of John C. Holt: The Creator of Trigramin
Introduction: John C. Holt is an accomplished inventor based in Philadelphia, PA, who has made significant contributions in the field of biomedical innovations. His groundbreaking work focuses on platelet aggregation inhibition, a critical area in medical research and treatment.
Latest Patents: Holt's most notable patent is for Trigramin, a 72-amino acid polypeptide designed to inhibit platelet aggregation. The patented amino acid sequence is as follows: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. Trigramin effectively inhibits fibrinogen binding to receptors on the glycoprotein IIb/IIIa complex located within the membrane of platelets. This action makes Trigramin a potent inhibitor of fibrinogen-induced human platelet aggregation, thus proving useful in preventing the formation of hemostatic platelet plugs.
Career Highlights: Currently, John C. Holt is affiliated with Temple University, where he continues his research and development efforts in the biomedical field. His dedication to innovation underscores the importance of ongoing research in understanding and fighting cardiovascular diseases.
Collaborations: Throughout his career, Holt has collaborated with notable coworkers such as Tur-Fu Huang and Stefan Niewiarowski. These partnerships are essential in fostering an environment of innovation and advancing research that impacts patient care and treatment options.
Conclusion: John C. Holt's contributions, particularly through his patent for Trigramin, highlight the intersection of science and innovation in the biomedical field. His work continues to pave the way for advancements that can significantly improve the quality of healthcare and patient outcomes.