The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Nov. 19, 1991
Filed:
Sep. 19, 1990
Applicant:
Inventors:
Tur-Fu Huang, Taipei, TW;
Stefan Niewiarowski, Narberth, PA (US);
John C Holt, Philadelphia, PA (US);
Hanna Lukasiewicz, Warsaw, PL;
Assignee:
Temple University of the Commonwealth System of Higher Education, Philadelphia, PA (US);
Attorney:
Primary Examiner:
Assistant Examiner:
Int. Cl.
CPC ...
C12N / ; A61K / ; C07K / ; C07K / ;
U.S. Cl.
CPC ...
4352402 ; 4352401 ; 514 12 ; 514 21 ; 514822 ; 530324 ; 530856 ;
Abstract
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.