Company Filing History:
Years Active: 1991
Title: **Hanna Lukasiewicz: Innovating Platelet Aggregation Inhibition**
Introduction
Hanna Lukasiewicz, an accomplished inventor based in Warsaw, Poland, has made significant strides in the field of biochemistry. With a focus on developing therapeutics, her work particularly addresses the inhibition of platelet aggregation, which plays a crucial role in clot formation and cardiovascular health.
Latest Patents
Among her achievements, Hanna holds a patent for Trigramin, a remarkable 72-amino acid polypeptide. The amino acid sequence of Trigramin is as follows: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. This innovative molecule serves as a potent inhibitor of fibrinogen binding to receptors on the glycoprotein IIb/IIIa complex located on the surface of platelets. Trigramin effectively inhibits human platelet aggregation induced by fibrinogen, making it an essential tool for preventing the formation of hemostatic platelet plugs.
Career Highlights
Hanna is currently affiliated with Temple University, where she collaborates on various research initiatives aimed at advancing medical science. Her unique contributions to the field of platelet aggregation inhibition have positioned her as a notable figure in her area of expertise.
Collaborations
Hanna's research is complemented by collaborations with esteemed colleagues, including Tur-Fu Huang and Stefan Niewiarowski. Their joint efforts have propelled advancements in the understanding and application of Trigramin, showcasing the significance of teamwork in the scientific community.
Conclusion
With her patent for Trigramin, Hanna Lukasiewicz continues to impact the field of biochemistry significantly. Her dedication to innovation and collaboration inspires future inventions that may pave the way for groundbreaking therapies in cardiovascular medicine.