Company Filing History:
1 out of 1,835 
1 out of 215 
1 out of 4 Years Active: 2021
Title: Innovations in Kidney Cancer Treatment by Jean-Luc Hoepffner
Introduction
Jean-Luc Hoepffner, based in Bordeaux, France, is a notable inventor recognized for his significant contribution to the field of oncology. With a keen focus on kidney cancer, he has developed innovative methods and pharmaceutical compositions aimed at improving treatment outcomes for patients suffering from this challenging disease.
Latest Patents
Hoepffner holds one patent that reveals novel approaches to treating kidney cancer. The patented methods showcase the use of Elabela (ELA), which is predominantly expressed in healthy kidneys but exhibits reduced expression in human kidney cancer. His research demonstrated that ELA can inhibit tumor progression in xenograft animal models, particularly through subcutaneous or sub-capsular administration. The disclosed method involves the administration of a therapeutically effective amount of an ELA polypeptide, with a specific amino acid sequence that has at least 90% identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP), allowing for certain mutations in specified arginine residues.
Career Highlights
Throughout his career, Jean-Luc Hoepffner has collaborated with prestigious institutions such as the Institut National de la Santé et de la Recherche Médicale and the Université de Bordeaux. His work is characterized by a commitment to advancing medical science and addressing pressing health challenges.
Collaborations
In addition to his institutional affiliations, Hoepffner has worked alongside esteemed colleagues, including Géraldine Siegfried and Abdel-Majid Khatib. Their collaborative efforts have further enhanced the depth and impact of his research, fostering a multidisciplinary approach toward innovative cancer treatments.
Conclusion
Jean-Luc Hoepffner's innovative solutions in the treatment of kidney cancer highlight the potential of targeted therapies utilizing Elabela. His dedication to research and collaboration underscores the importance of continued innovation in the medical field, paving the way for improved health outcomes for patients battling this disease. With a profound understanding of the complexities of cancer biology, Hoepffner stands as a key figure in the pursuit of effective therapeutic strategies.