The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.

The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.

Date of Patent:
Jul. 06, 2021

Filed:

Oct. 04, 2017
Applicants:

Inserm (Institut National DE LA Santé ET DE LA Recherche Médicale), Paris, FR;

Universite DE Bordeaux, Bordeaux, FR;

Institut Bergonié, Bordeaux, FR;

Inventors:

Géraldine Siegfried, Pessec, FR;

Abdel-Majid Khatib, Pessac, FR;

Jean-Luc Hoepffner, Bordeaux, FR;

Serge Evrard, Bordeaux, FR;

Attorney:
Primary Examiner:
Assistant Examiner:
Int. Cl.
CPC ...
A61K 38/22 (2006.01); A61P 35/00 (2006.01); C07K 14/575 (2006.01);
U.S. Cl.
CPC ...
A61K 38/22 (2013.01); A61P 35/00 (2018.01); C07K 14/575 (2013.01);
Abstract

Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.


Find Patent Forward Citations

Loading…