This inventor holds 1 USPTO granted patent. Top assignee: Adprotech Limited. Active years: 2004.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile
Company Filing History:
Years Active: 2004
Title: Colin Michael Edge: Innovator in Therapeutic Polypeptides
Introduction
Colin Michael Edge is a notable inventor based in Harlow, GB. He has made significant contributions to the field of therapeutic polypeptides, showcasing his expertise through innovative patents.
Latest Patents
Colin holds a patent titled "Fragments of CR1 and their use." This patent describes a polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, which is 6-23 amino acids in length. The polypeptide includes sequences a) GGRKVF and b) FELVGEPSIY, along with multimeric and chimeric derivatives. Additionally, it covers pharmaceutical compositions containing these polypeptides and their therapeutic applications.
Career Highlights
Colin is associated with Adprotech Limited, where he continues to advance his research and development efforts. His work focuses on the application of his patented polypeptides in therapeutic settings, contributing to the medical field.
Collaborations
Colin has collaborated with notable colleagues, including Danuta Ewa Irena Mossakowska and Richard Anthony Godwin Smith. Their combined expertise enhances the innovative potential of their projects.
Conclusion
Colin Michael Edge is a distinguished inventor whose work in therapeutic polypeptides has the potential to impact medical treatments significantly. His contributions through patents and collaborations reflect his commitment to advancing healthcare solutions.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile