Harlow, United Kingdom

Colin Michael Edge


Average Co-Inventor Count = 3.0

ph-index = 1


Company Filing History:


Years Active: 2004

Loading Chart...
1 patent (USPTO):Explore Patents

Title: Colin Michael Edge: Innovator in Therapeutic Polypeptides

Introduction

Colin Michael Edge is a notable inventor based in Harlow, GB. He has made significant contributions to the field of therapeutic polypeptides, showcasing his expertise through innovative patents.

Latest Patents

Colin holds a patent titled "Fragments of CR1 and their use." This patent describes a polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, which is 6-23 amino acids in length. The polypeptide includes sequences a) GGRKVF and b) FELVGEPSIY, along with multimeric and chimeric derivatives. Additionally, it covers pharmaceutical compositions containing these polypeptides and their therapeutic applications.

Career Highlights

Colin is associated with Adprotech Limited, where he continues to advance his research and development efforts. His work focuses on the application of his patented polypeptides in therapeutic settings, contributing to the medical field.

Collaborations

Colin has collaborated with notable colleagues, including Danuta Ewa Irena Mossakowska and Richard Anthony Godwin Smith. Their combined expertise enhances the innovative potential of their projects.

Conclusion

Colin Michael Edge is a distinguished inventor whose work in therapeutic polypeptides has the potential to impact medical treatments significantly. His contributions through patents and collaborations reflect his commitment to advancing healthcare solutions.

This text is generated by artificial intelligence and may not be accurate.
Please report any incorrect information to support@idiyas.com
Loading…