The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Sep. 28, 2004
Filed:
Dec. 01, 1998
Applicant:
Inventors:
Danuta Ewa Irena Mossakowska, Harlow, GB;
Colin Michael Edge, Harlow, GB;
Richard Anthony Godwin Smith, Herts, GB;
Assignee:
AdProTech Limited, Essex, GB;
Attorney:
Primary Examiner:
Assistant Examiner:
Int. Cl.
CPC ...
C07K 1/447 ; A61K 3/816 ;
U.S. Cl.
CPC ...
C07K 1/447 ; A61K 3/816 ;
Abstract
A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multimeric and chimeric derivatives, pharmaceutiocal compositions containing them and their use in therapy.