Bethesda, MD, United States of America

C David Pendelton

This inventor holds 1 USPTO granted patent. Top assignee: The United States of America as Represented by the Department of Health. Active years: 1999.


% Patents Active = 100.0

Average Co-Inventor Count = 5.0

ph-index = 1

Forward Citations = 4(Granted Patents)


Company Filing History:


Years Active: 1999

Loading Chart...
1 patent (USPTO):Explore Patents

Title: C David Pendelton: Innovator in Immunology

Introduction

C David Pendelton is a notable inventor based in Bethesda, MD (US). He has made significant contributions to the field of immunology, particularly in the development of peptides that elicit immune responses against human immunodeficiency virus type 1 (HIV-1). His work is crucial in advancing our understanding of immune responses and potential treatments for viral infections.

Latest Patents

C David Pendelton holds a patent for a multideterminant peptide designed to elicit helper T-lymphocyte and cytotoxic T-lymphocyte responses. This invention is directed toward a multideterminant HIV-1 peptide that comprises a covalently linked T-helper lymphocyte epitope, cytotoxic T-lymphocyte epitope, and an epitope capable of eliciting a neutralizing antibody response. The peptide has the amino acid sequence: KQIINMWQEVGKAMYAPPISGQIRRIHIGPGRAFYTTKN. This innovative peptide is characterized by its ability to evoke all three immune responses in hosts with a broad range of major histocompatibility complex types. It serves as an immunogen to generate broad immune responses, assess immune responses in virally infected hosts, and act as a diagnostic reagent for detecting viral infections.

Career Highlights

C David Pendelton works for the United States of America as represented by the Department of Health. His career is marked by a commitment to advancing immunological research and developing innovative solutions to combat viral infections. His work has implications for vaccine development and therapeutic strategies against HIV-1.

Collaborations

C David Pendelton has collaborated with notable colleagues such as Jay A Berzofsky and Jeffrey D Ahlers. These collaborations have contributed to the advancement of research in immunology and the development of effective immunogens.

Conclusion

C David Pendelton's contributions to the field of immunology through his innovative peptide patent highlight his role as a significant inventor in the fight against viral infections. His work continues to influence research and development in immunological therapies.

This text is generated by artificial intelligence and may not be accurate.
Please report any incorrect information to [email protected]
Loading…