Aurau, Switzerland

Barbara Zubler


Average Co-Inventor Count = 7.0

ph-index = 1


Company Filing History:


Years Active: 2020-2022

Loading Chart...
2 patents (USPTO):Explore Patents

Title: **Barbara Zubler: Pioneering Innovator in FGFR3 Binding Molecules**

Introduction

Barbara Zubler is an accomplished inventor based in Aurau, Switzerland. With a keen focus on biochemistry, she has successfully secured two patents, significantly contributing to the field of medical science through her innovative work.

Latest Patents

Her latest invention revolves around FGFR3 binding molecules. This innovation pertains to a polypeptide that binds to specific fibroblast growth factor receptor 3 isoforms, namely FGFR3b and FGFR3c. The polypeptide is characterized by several amino acid sequences, one of which includes: GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X)(X)(X)(X)GPYWEARSL(X)TGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 1). Additionally, her formulation encompasses variations that maintain 95% identity with the original sequences, emphasizing the conservation of critical amino acids, which highlights the sophistication of her research.

Career Highlights

Barbara has demonstrated an impressive career trajectory, having worked with prestigious companies such as Cilag International GmbH and Covagen AG. Her experience in these organizations has equipped her with the necessary expertise to innovate effectively within her field.

Collaborations

Throughout her career, Barbara has collaborated with notable professionals, including Michela Silacci Melkko and Richard Woods. These partnerships have fostered an environment of creativity and shared knowledge, enhancing her research outcomes.

Conclusion

Barbara Zubler stands as a beacon of innovation in the biotechnology industry. Her contributions, particularly in developing FGFR3 binding molecules, are making significant advancements in understanding receptor interactions, which could pave the way for future therapeutic developments. Her work exemplifies the vital role of inventors in transforming scientific concepts into practical solutions.

This text is generated by artificial intelligence and may not be accurate.
Please report any incorrect information to support@idiyas.com
Loading…