The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.

The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.

Date of Patent:
Jun. 07, 2022

Filed:

Jun. 15, 2020
Applicant:

Covagen Ag, Zug, CH;

Inventors:

Michela Silacci Melkko, Zurich, CH;

Richard Woods, Zurich, CH;

Patricia Henne, London, GB;

Barbara Zubler, Aurau, CH;

Elena Kage, Dietikon, CH;

Dragan Grabulovski, Zurich, CH;

Julian Bertschinger, Ottenbach, CH;

Assignee:
Attorney:
Primary Examiner:
Int. Cl.
CPC ...
A61K 47/64 (2017.01); C07K 16/28 (2006.01); C07K 16/30 (2006.01); C07K 19/00 (2006.01); A61K 39/395 (2006.01); A61K 39/00 (2006.01); A61P 35/00 (2006.01); C12N 9/12 (2006.01);
U.S. Cl.
CPC ...
A61K 47/6425 (2017.08); A61K 47/6415 (2017.08); A61P 35/00 (2018.01); C07K 16/289 (2013.01); C07K 16/2863 (2013.01); C07K 16/2878 (2013.01); C07K 16/2887 (2013.01); C07K 16/30 (2013.01); C07K 19/00 (2013.01); C12N 9/12 (2013.01); C12Y 207/10002 (2013.01); A61K 39/39558 (2013.01); A61K 2039/505 (2013.01); C07K 2317/732 (2013.01); C07K 2318/10 (2013.01); C07K 2319/30 (2013.01); C07K 2319/75 (2013.01);
Abstract

The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X)(X)(X) (X)GPYWEARSL(X)TGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Yin amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.


Find Patent Forward Citations

Loading…