This inventor holds 1 USPTO granted patent. Top assignee: King Faisal University. Active years: 2023.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile
Company Filing History:
Years Active: 2023
Title: Abdullah I Al-Mubarak: Innovator in Coronavirus Research
Introduction
Abdullah I Al-Mubarak is a notable inventor based in Al-Ahsa, Saudi Arabia. He has made significant contributions to the field of virology, particularly in the development of inhibitors for human coronaviruses. His work is crucial in the ongoing fight against viral infections.
Latest Patents
Al-Mubarak holds a patent for "Fusion peptide inhibitors of human coronavirus 229E." This patent includes several specific peptides designed to inhibit or prevent the cellular entry of HCoV-229E. The peptides listed in the patent are peptide #1 (SEQ ID NO: 1: SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL), peptide #4 (SEQ ID NO: 2: SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL), and peptide #11 (SEQ ID NO: 11: SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL). These inhibitors may also be utilized in assays aimed at inhibiting HCoV-229E.
Career Highlights
Al-Mubarak is affiliated with King Fahd University of Petroleum and Minerals, where he conducts his research. His academic and professional background has equipped him with the skills necessary to innovate in the field of infectious diseases.
Collaborations
One of his notable collaborators is Mahmoud Elsayed. Their partnership has likely contributed to the advancements in their research endeavors.
Conclusion
Abdullah I Al-Mubarak is a key figure in the development of antiviral therapies, particularly against human coronaviruses. His innovative work continues to have a significant impact on public health.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile