This inventor holds 2 USPTO granted patents. Top assignee: Garvan Institute of Medical Research. Active years: 1996-1998.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile
Company Filing History:
Years Active: 1996-1998
Title: The Innovations of John Shine
Introduction
John Shine is a notable inventor based in Woolwich, Australia. He has made significant contributions to the field of medical research, particularly in the area of neuropeptides. With a total of two patents to his name, Shine's work has implications for therapeutic applications.
Latest Patents
Shine's latest patents include innovations related to human galanin and the human neuropeptide Y-Y1 receptor. The first patent provides a peptide with the amino acid sequence of human galanin, specifically GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). This invention also encompasses DNA clones encoding the peptide and explores its therapeutic uses.
Career Highlights
John Shine is affiliated with the Garvan Institute of Medical Research, where he has been instrumental in advancing research in neuropeptides. His work has garnered attention for its potential applications in medicine and therapeutic interventions.
Collaborations
Shine has collaborated with notable colleagues, including Lisa Selbie and Herbert Herzog, contributing to a dynamic research environment that fosters innovation.
Conclusion
John Shine's contributions to the field of medical research through his patents and collaborations highlight his role as a significant inventor. His work continues to pave the way for advancements in therapeutic applications.
Data source: USPTO (United States Patent and Trademark Office) public patent records. Weekly synchronization. How IDiyas builds this profile