Woolwich, Australia

John Shine


Average Co-Inventor Count = 2.4

ph-index = 2

Forward Citations = 10(Granted Patents)


Company Filing History:


Years Active: 1996-1998

Loading Chart...
2 patents (USPTO):Explore Patents

Title: The Innovations of John Shine

Introduction

John Shine is a notable inventor based in Woolwich, Australia. He has made significant contributions to the field of medical research, particularly in the area of neuropeptides. With a total of two patents to his name, Shine's work has implications for therapeutic applications.

Latest Patents

Shine's latest patents include innovations related to human galanin and the human neuropeptide Y-Y1 receptor. The first patent provides a peptide with the amino acid sequence of human galanin, specifically GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). This invention also encompasses DNA clones encoding the peptide and explores its therapeutic uses.

Career Highlights

John Shine is affiliated with the Garvan Institute of Medical Research, where he has been instrumental in advancing research in neuropeptides. His work has garnered attention for its potential applications in medicine and therapeutic interventions.

Collaborations

Shine has collaborated with notable colleagues, including Lisa Selbie and Herbert Herzog, contributing to a dynamic research environment that fosters innovation.

Conclusion

John Shine's contributions to the field of medical research through his patents and collaborations highlight his role as a significant inventor. His work continues to pave the way for advancements in therapeutic applications.

This text is generated by artificial intelligence and may not be accurate.
Please report any incorrect information to support@idiyas.com
Loading…