Company Filing History:
Years Active: 1998
Title: Helen Frances Evans: Innovator in Human Galanin Research
Introduction
Helen Frances Evans is a notable inventor based in Bondi Junction, Australia. She has made significant contributions to the field of medical research, particularly in the study of human galanin. Her work has implications for therapeutic applications, showcasing her innovative spirit and dedication to advancing science.
Latest Patents
Helen Frances Evans holds a patent for her invention titled "Human galanin, CDNA clones encoding human galanin and a method of." This patent includes a peptide with the amino acid sequence: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The invention not only provides the peptide but also includes DNA clones encoding it, along with potential therapeutic uses.
Career Highlights
Helen is affiliated with the Garvan Institute of Medical Research, where she conducts her research. Her work at this prestigious institution has allowed her to explore the complexities of human galanin and its potential benefits in medical treatments.
Collaborations
Helen has collaborated with John Shine, a fellow researcher, to further her studies and enhance the impact of her work in the scientific community.
Conclusion
Helen Frances Evans is a pioneering inventor whose research on human galanin has opened new avenues for therapeutic applications. Her contributions to medical science are invaluable and continue to inspire future innovations.
Inventor’s Patent Attorneys refers to legal professionals with specialized expertise in representing inventors throughout the patent process. These attorneys assist inventors in navigating the complexities of patent law, including filing patent applications, conducting patent searches, and protecting intellectual property rights. They play a crucial role in helping inventors secure patents for their innovative creations.