Bondi Junction, Australia

Helen Frances Evans


Average Co-Inventor Count = 2.0

ph-index = 1

Forward Citations = 2(Granted Patents)


Company Filing History:


Years Active: 1998

Loading Chart...
1 patent (USPTO):Explore Patents

Title: Helen Frances Evans: Innovator in Human Galanin Research

Introduction

Helen Frances Evans is a notable inventor based in Bondi Junction, Australia. She has made significant contributions to the field of medical research, particularly in the study of human galanin. Her work has implications for therapeutic applications, showcasing her innovative spirit and dedication to advancing science.

Latest Patents

Helen Frances Evans holds a patent for her invention titled "Human galanin, CDNA clones encoding human galanin and a method of." This patent includes a peptide with the amino acid sequence: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The invention not only provides the peptide but also includes DNA clones encoding it, along with potential therapeutic uses.

Career Highlights

Helen is affiliated with the Garvan Institute of Medical Research, where she conducts her research. Her work at this prestigious institution has allowed her to explore the complexities of human galanin and its potential benefits in medical treatments.

Collaborations

Helen has collaborated with John Shine, a fellow researcher, to further her studies and enhance the impact of her work in the scientific community.

Conclusion

Helen Frances Evans is a pioneering inventor whose research on human galanin has opened new avenues for therapeutic applications. Her contributions to medical science are invaluable and continue to inspire future innovations.

This text is generated by artificial intelligence and may not be accurate.
Please report any incorrect information to support@idiyas.com
Loading…