This inventor holds 5 USPTO granted patents. Top assignee: Celtrix Pharmaceuticals, Inc.. Active years: 1993-1997.
Company Filing History:
Years Active: 1993-1997
Title: Innovator David K. Schmidt: Pioneering Advances in TGF-Beta Research
Introduction
David K. Schmidt is an influential inventor based in Santa Cruz, CA, who has made significant contributions to the field of biomedical research. With a remarkable portfolio of 5 patents, he focuses on the discovery and development of biologically active peptides, particularly relating to transforming growth factors (TGF).
Latest Patents
Among his notable patents are advancements related to biologically active TGF-beta1 and TGF-beta2 peptides. His invention concerning TGF-beta1 includes peptides that correspond to certain amino acid sequences, retaining biological activity in both monomeric and polymeric forms. The specific monomeric sequence for TGF-beta1 is CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP (SEQ ID NO: 1), while the corresponding sequence for TGF-beta2 is CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA (SEQ ID NO: 2). Additionally, his work on a heterodimeric form of TGF-beta2/3 elucidates its role in inhibiting epithelial cell growth, leading to promising therapeutic applications.
Career Highlights
David K. Schmidt's career has been marked by a focus on innovative research that bridges molecular biology and therapeutic applications. His expertise in peptide synthesis and protein characterization has positioned him as a key player at Celtrix Pharmaceuticals, Inc., where he further explores the potential of TGF peptides in clinical settings.
Collaborations
Throughout his career, Schmidt has collaborated with talented researchers such as Yasushi Ogawa and Rosa Armstrong. Their joint efforts have fostered an environment of creativity and scientific advancement, leading to groundbreaking insights in the field of molecular therapeutics.
Conclusion
David K. Schmidt stands out as a pioneering inventor whose work on TGF peptides has the potential to provide breakthroughs in medical treatment and understanding of cellular growth regulation. His ongoing research and collaborative spirit continue to inspire innovation within the scientific community.