The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Apr. 19, 2016
Filed:
Sep. 19, 2013
Covagen Ag, Schlieren, CH;
Michela Sillacci Melkko, Schlieren, CH;
Nadja Banziger, Schlieren, CH;
Richard Woods, Schlieren, CH;
Wenjuan Zha, Schlieren, CH;
Isabella Attinger, Schlieren, CH;
Roger Santimaria, Schlieren, CH;
Wibke Lembke, Schlieren, CH;
Sarah Batey, Schlieren, CH;
Ulrike Von Der Bey, Schlieren, CH;
Julian Bertschinger, Schlieren, CH;
Dragan Grabulovski, Schlieren, CH;
Covagen AG, Schlieren, CH;
Abstract
The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)(X)(X)(X)(X)(X) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X) to (X) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.