The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Jun. 22, 2010
Filed:
Aug. 16, 2005
Applicants:
Wolf-georg Forssmann, Hannover, DE;
Frank Kirchhoff, Ulm, DE;
Jan Münch, Ulm, DE;
Ludger Ständker, Hannover, DE;
Inventors:
Wolf-Georg Forssmann, Hannover, DE;
Frank Kirchhoff, Ulm, DE;
Jan Münch, Ulm, DE;
Ludger Ständker, Hannover, DE;
Assignee:
IPF PharmaCeuticals GmbH, Hannover, DE;
Attorneys:
Primary Examiner:
Int. Cl.
CPC ...
A61K 38/17 (2006.01);
U.S. Cl.
CPC ...
Abstract
The present invention relates to the use of a peptide having the amino acid sequence NH-VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH-COOH (SEQ ID NO:) as well as variants, derivatives and fragments of the peptide for the treatment of viral diseases.