The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Sep. 16, 2008
Filed:
Jun. 25, 2004
Matthew Baker, Cambridge, GB;
John Watkins, Cambridge, GB;
Matthew Baker, Cambridge, GB;
John Watkins, Cambridge, GB;
Merck Patent GmbH, Darmstadt, DE;
Abstract
Modified forms of hirudin having improved properties are disclosed. The modified hirudin compounds are hirudin variants comprising amino acid substitutions in the sequence of hirudin. Peptide molecules consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE (SEQ ID NO: 1) or a sequence consisting of at least 9 consecutive amino acid residues of SEQ ID NO: 1 having a potential MHC class II binding activity are disclosed. The peptide has a stimulation index of >1.8 in a biological assay of cellular proliferation, in which the index is defined as the value of cellular proliferation scored following stimulation by the peptide and divided by the value of cellular proliferation scored in control cells that have not been exposed to the peptide.