The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.

The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.

Date of Patent:
Apr. 15, 2008

Filed:

May. 21, 2002
Applicants:

Halle Morton, Coorparoo, AU;

Alice Christina Cavanagh, Ashgrove, AU;

Inventors:

Halle Morton, Coorparoo, AU;

Alice Christina Cavanagh, Ashgrove, AU;

Assignee:
Attorney:
Primary Examiner:
Int. Cl.
CPC ...
A61K 38/00 (2006.01);
U.S. Cl.
CPC ...
Abstract

Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSMAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQ ATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDIL GKYVD (SEQ ID NO:). Antibodies are raised against either the entire sequence of cpnor a shorter peptide sequence derived from cpnsuch as Ac-AGQAFRKFLPL (SEQ ID NO:), ACQAFRKFLPL (SEQ ID NO), or EKSQGKVLQAT (SEQ ID NO:), in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.


Find Patent Forward Citations

Loading…