The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Mar. 11, 2003
Filed:
May. 10, 2000
Applicant:
Inventors:
Andrew Jeremy Dunbar, Adelaide, AU;
Christopher Goddard, Blackwood, AU;
David Andrew Belford, Seacliff, AU;
Assignee:
Gropep Pty Ltd., South Australia, AU;
Attorney:
Primary Examiner:
Assistant Examiner:
Int. Cl.
CPC ...
A61K 3/900 ; A61K 3/800 ; C07K 1/400 ; C07K 1/700 ; C12P 2/106 ;
U.S. Cl.
CPC ...
A61K 3/900 ; A61K 3/800 ; C07K 1/400 ; C07K 1/700 ; C12P 2/106 ;
Abstract
A mammalian milk growth factor (MMGF) having the following amino acid sequence or substantially homologous sequence: DGNSTRSPEDDGLLCGDHAENCPATTTQPKRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFY (SEQ ID NO:2) or a mutant, analogue, derivative or functionally active fragment thereof.