The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Jul. 09, 2002
Filed:
Feb. 23, 1999
Applicant:
Inventors:
Halle Morton, Coorparoo, AU;
Alice Christina Cavanagh, Ashgrove, AU;
Assignee:
The University of Queensland, Queensland, AU;
Attorney:
Primary Examiner:
Int. Cl.
CPC ...
C07K 1/606 ; C07K 1/618 ; C07K 1/644 ; C07K 1/626 ;
U.S. Cl.
CPC ...
C07K 1/606 ; C07K 1/618 ; C07K 1/644 ; C07K 1/626 ;
Abstract
Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD. Antibodies are raised against either the entire sequence of cpn10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKLPI.,AGQAFRKFI.PI., or EKSQGKVLQAT, in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.