The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Sep. 05, 2000
Filed:
May. 29, 1996
Halle Morton, Coorparoo, AU;
Alice Christina Cavanagh, Ashgrove, AU;
The University of Queensland, Queensland, AU;
Abstract
An antagonist to, or an antibody (Ab) raised against, cpn10 or a recombinant cpn10 with the sequence: GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD is claimed. Also, claimed are: (1) an antagonist or Ab raised against a peptide derived from cpn10, or a peptide with the sequence: Ac-AGQAFRKLPL(C) AGQAFRKFLPLA2 A1AGQAFRKFLPL Ac-A1AGQAFRKFLPL (A1)EKSQGKVLQATA2 A1EKSQGKVLQAT where A1 and A2 are amino acid sequences that may be added to one or both ends of the peptides, and where the peptides may have a single amino acid deletion, addition or substitution; (2) suppressing cellular growth or enhancing immunological activity by admin. of a cpn10 antagonist or anti-cpn10 Ab to a subject; and (3) an assay for measuring anti-cpn10 Ab in a sample by: (a) reacting purified cpn10 with the sample (b) determining the amt. of Ab in the sample by determining the binding between the Ab and cpn10. USE--The cpn 10 antagonist or Ab can be used to terminate pregnancy, suppressing tumour cell growth or enhancing the immune system.