The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.
The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.
Patent No.:
Date of Patent:
Aug. 15, 2023
Filed:
Jan. 25, 2016
Applicant:
Erasmus University Medical Center Rotterdam, Rotterdam, NL;
Inventor:
Peterus Leonardus Josephus de Keizer, Rotterdam, NL;
Assignee:
Erasmus University Medical Center Rotterdam, Rotterdam, NL;
Attorney:
Primary Examiner:
Assistant Examiner:
Int. Cl.
CPC ...
A61K 38/08 (2019.01); A61K 38/10 (2006.01); A61K 38/17 (2006.01); C07K 14/47 (2006.01);
U.S. Cl.
CPC ...
A61K 38/10 (2013.01); A61K 38/17 (2013.01); C07K 14/4702 (2013.01); C07K 14/4747 (2013.01); C07K 2319/10 (2013.01);
Abstract
The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders.