logo

For the Inventor, By the Inventor

The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.

The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.

Patent No.:

US 10487307 B1

PDFFull Text
Date of Patent:
Nov. 26, 2019

Filed:

Mar. 09, 2016

Culture method for pluripotent stem cells

Applicant:

Fujifilm Corporation, Minato-ku, Tokyo, JP;

Inventors:

Yuta Murakami, Kanagawa, JP;

Sanae Nomiyama, Kanagawa, JP;

Keita Hagiya, Kanagawa, JP;

Yuichi Yoshino, Kanagawa, JP;

Rie Hando, Kanagawa, JP;

Yoshihide Iwaki, Kanagawa, JP;

Tasuku Sasaki, Kanagawa, JP;

Assignee:

FUJIFILM CORPORATION, Tokyo, JP;

Attorney:

Solaris Intellectual Property Group, PLLC

Primary Examiner:

Anoop K Singh

Int. Cl.
CPC ...
C07K 14/78 (2006.01); C12N 5/071 (2010.01); C12N 5/00 (2006.01); C12N 5/074 (2010.01);
U.S. Cl.
CPC ...
C12N 5/0068 (2013.01); C12N 5/0696 (2013.01); C12N 2500/25 (2013.01); C12N 2500/32 (2013.01); C12N 2500/38 (2013.01); C12N 2500/90 (2013.01); C12N 2501/119 (2013.01); C12N 2501/15 (2013.01); C12N 2533/30 (2013.01); C12N 2533/50 (2013.01);
Abstract

A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 μM in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.

Find Patent Forward Citations

Loading…