The patent badge is an abbreviated version of the USPTO patent document. The patent badge does contain a link to the full patent document.

The patent badge is an abbreviated version of the USPTO patent document. The patent badge covers the following: Patent number, Date patent was issued, Date patent was filed, Title of the patent, Applicant, Inventor, Assignee, Attorney firm, Primary examiner, Assistant examiner, CPCs, and Abstract. The patent badge does contain a link to the full patent document (in Adobe Acrobat format, aka pdf). To download or print any patent click here.

Date of Patent:
Sep. 10, 2019

Filed:

Oct. 12, 2016
Applicant:

Fujifilm Corporation, Minato-ku, Tokyo, JP;

Inventors:

Yuta Murakami, Kanagawa, JP;

Rie Iwata, Kanagawa, JP;

Yoshihide Iwaki, Kanagawa, JP;

Tasuku Sasaki, Kanagawa, JP;

Assignee:
Attorney:
Primary Examiner:
Int. Cl.
CPC ...
C07K 14/78 (2006.01); C12N 5/00 (2006.01); C12N 5/074 (2010.01); C07K 14/00 (2006.01); C07K 14/47 (2006.01); C12N 15/63 (2006.01);
U.S. Cl.
CPC ...
C12N 5/0068 (2013.01); C07K 14/001 (2013.01); C07K 14/47 (2013.01); C07K 14/78 (2013.01); C12N 5/0607 (2013.01); C12N 5/0696 (2013.01); C12N 2533/50 (2013.01); C12N 2533/52 (2013.01); C12N 2537/00 (2013.01);
Abstract

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.


Find Patent Forward Citations

Loading…