Fujifilm Corporation

Yuichi Yoshino

Kentaro Nakamura

Yoshihide Iwaki

Tasuku Sasaki

Yuta Murakami

Rie Hando

Rie Iwata

Keita Hagiya

Sanae Nomiyama

A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 &#x3bc;M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.

Culture method for pluripotent stem cells

A polypeptide having an amino acid sequence in which the number of RGD sequences contained per molecular weight of 10 kDa is not less than 0.30; the number of GFPGER sequences contained per molecular weight of 10 kDa is not less than 0.15; and the number of GVMGFP sequences contained per molecular weight of 10 kDa is less than 0.30; is provided. A scaffold composition, a composition for repairing a cartilage tissue, a composition for culturing cartilage cells, and a composition for promoting glycosaminoglycan production, which compositions contain the above polypeptide, are also provided.

Polypeptide, scaffold composition, composition for cartilage tissue restoration, composition for cartilage cell culture, and composition for promoting glycosaminoglycan production

Growing community of inventors

Kanagawa, Japan

Yuichi Yoshino