Fujifilm Corporation

Fuji Photo Film Company, Limited

Yoshihide Iwaki

Hideaki Tanaka

Yoshiki Sakaino

Kaoru Terashima

Kentarou Nakamura

Osamu Seshimoto

Toshihiro Mori

Hiroshi Shinoki

Hayato Miyoshi

Tasuku Sasaki

Yuta Murakami

Hitoshi Shimizu

Rie Hando

Keita Hagiya

Makoto Ono

Naoyuki Nishikawa

Hideyuki Karaki

Yoshihiko Makino

Yoshikazu Amano

Akira Wakabayashi

Susumu Sugiyama

Kouki Nakamura

Kazuya Kawasaki

Shinji Mima

Yoshihiro Sawayashiki

Tsukasa Kitahashi

Rie Iwata

Yuichi Yoshino

Sanae Nomiyama

Ichizou Toya

Sanae Morioka

Kouo Suzuki

An object of the present invention is to provide an anti-tumor agent and an anti-tumor kit which have superior anti-tumor effect as compared with a therapy with gemcitabine, paclitaxel or a combination thereof; as well as an anti-tumor effect enhancer. According to the present invention, provided is an anti-tumor agent including paclitaxel or a salt thereof and 1-(2-deoxy-2-fluoro-4-thio-&#x3b2;-D-arabinofuranosyl)cytosine or a salt or prodrug thereof.

Anti-tumor agent, anti-tumor effect enhancer, and anti-tumor kit

A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 &#x3bc;M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.

Culture method for pluripotent stem cells

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Method of culturing pluripotent stem cell, and polypeptide to be used therefor

An object of the present invention is to provide lipid particles which have low cytotoxicity, can stably hold nucleic acid molecules outside cells, and can promptly release nucleic acids in cytoplasm after escaping from endosome, and a nucleic acid delivery carrier. According to the present invention, there are provided lipid particles containing a compound represented by the following General Formula (1), sterol, at least one lipid selected from the group consisting of a neutral lipid and a lipid having a polyethylene glycol chain, and nucleic acids, and a nucleic acid delivery carrier.  In the formula, Rand Rare the same as or different from each other, and are alkyl groups having 10 to 22 carbon atoms.

Lipid particles and nucleic acid delivery carrier

A polypeptide composition induces a pluripotent stem cell culturing property, particularly, an excellent cell growth ability. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. The polypeptide composition includes a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, in an amount equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. A culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.

Polypeptide composition and culture method for pluripotent stem cell using same

An object to be achieved by the present invention is to provide a nucleic acid amplification method by which a nucleic acid can be amplified substantially isothermally using oligonucleotide primers and DNA polymerase capable of strand displacement. The present invention provides a nucleic acid amplification method which comprises performing substantially isothermal incubation of a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase having strand displacement activity, a divalent cation, at least 0.01% or more surfactant, at least two types of oligonucleotide primer, and the nucleic acid fragment as a template so as to perform a polymerase reaction that initiates from the 3' end of the primer and thus amplifying the nucleic acid fragment.

Isothermal nucleic acid amplification method using surfactant

An object to be achieved by the present invention is to provide a nucleic acid amplification method by which a nucleic acid can be amplified using oligonucleotide primers and DNA polymerase. The present invention provides a nucleic acid amplification method which comprises performing incubation of a reaction solution containing at least one type of deoxynucleotide triphosphate, at least one type of DNA polymerase, at least two types of oligonucleotide primer, and the nucleic acid fragment as a template so as to perform a polymerase reaction that initiates from the 3' end of the primer and thus amplifying the nucleic acid fragment, wherein a tag sequence is added at the 5&#x2032; end of the first oligonucleotide primer, and the tag sequence is a nucleotide sequence on the template nucleic acid fragment which is present downstream of the sequence which is substantially complementary with the 3&#x2032; end region of the first oligonucleotide primer (a region where the first oligonucleotide is annealed to the template nucleic acid).

Nucleic acid amplification method

The present invention describes methods for discriminating between nucleotide sequences of first and second nucleic acids, including: providing a reaction solution, including a deoxynucleotide triphosphate, a DNA polymerase with strand displacement ability, a template nucleic acid fragment, a primer, and a mask oligo; incubating the reaction solution, obtaining a polymerase reaction, and producing an amplification product; detecting the amplification product to discriminate between the nucleotide sequences, wherein the primer is complementary to the first nucleic acid, the mask oligo hybridizes to the nucleotide sequence portion of the first and second nucleic acid, wherein the mask oligo is more complementary to the second nucleic acid than to the first nucleic acid, and wherein the mask oligo is not an origin of an elongation reaction with the polymerase, and a primer portion and a mask oligo portion hybridize to the same regions on the first and second nucleic acid.

Method for discriminating between nucleotide sequences of nucleic acids

A humoral testing apparatus in which a measuring light is irradiated to a reagent area forming a color as a result of a reaction and an optical density of the reagent area is detected by a detecting operation of light intensity of the reflected light. The humoral testing apparatus enables a humoral test to be performed accurately in cases where nonuniformity occurs with the reaction of a reagent with a humoral sample within the reagent area, or in cases where fine dust is present within each detecting spot in the reagent areas. The light reflected from the reagent areas is detected with a two-dimensional photodetector. The independent light intensity detecting operations are performed with respect to the subareas of the reagent area of a reagent layer. A photo detection signal S, which represents the intensity of the reflected light is statistically processed with a signal processing section 51.

Humoral testing apparatus

A blood testing unit is provided with a closed vessel having an outer vessel body and an inner vessel body, and a reagent layer is accommodated in the closed vessel. Reagents which react with a blood sample are supported on the reagent layer. The closed vessel is comprised such that at least either one of the outer vessel body and the inner vessel body is provided with an aperture, through which air is capable of being introduced from the exterior to the interior of the one vessel body, and the one vessel body is provided with a sealing member for closing the aperture.

Humoral testing unit

A blood testing unit comprises a closed vessel having a blood introducing section formed at a certain area of the closed vessel. A blood constituent separating section is located within the closed vessel to separate plasma and/or serum from the blood sample introduced through the blood introducing section into the closed vessel. A reagent layer is located within the closed vessel, such that the reagent layer can be seen from the exterior. The reagent layer comprises a region for spreading the plasma and/or the serum, which has been separated by the blood constituent separating section from the blood sample, and a reagent supporte donor in the spreading region, the reagent undergoing a reaction with the plasma and/or the serum and forming a color as a result of the reaction.

Blood testing unit and blood testing method and apparatus

The present invention provides a method for detecting fluorescence by using a solid support to which a probe molecule to be detected is fixed, wherein background is reduced by using a quenching agent. By using present invention, detection sensitivity of a DNA chip can be increased and stable data can be obtained.

Method of reducing background in fluoresence detection

An object of the present invention is to provide a means for simply performing a gene analysis without performing complicated operations. The present invention provides a method for the detection of a nucleic acid, comprising the steps of: performing a PCR reaction or a reverse transcription reaction by adding a template nucleic acid to a solid support on which a nucleic acid is fixed; and hybridizing the nucleic acid fixed on said solid support with the nucleic acid synthesized by the PCR reaction or the reverse transcription reaction.

Method for the detection of gene with DNA micro-array

A plurality of different kinds of reagents are supported at different positions on a reagent layer. A humoral testing apparatus irradiates measuring light which has a wavelength adapted to one of the plurality of the reagent areas which forms a color, and detects the intensity of the light reflected from the reagent areas with the photodetector with respect to each of the reagents, and thus detects the optical densities of the reagent areas.

Humoral testing unit and a humoral testing apparatus

This invention relates to a dry analytical element using a water-soluble indicator which improves measuring accuracy, which comprises a water-impermeable support, a water-permeable layer and a spreading layer having a function to spread a liquid uniformly, wherein a water-soluble indicator for colorimetry is incorporated into the s preading layer.

Growing community of inventors

Kanagawa, Japan

Yoshihide Iwaki