Microsoft Technology Licensing, LLC

Alibaba Group Holding Limited

Zhejiang University

The Hong Kong University of Science and Technology

Ningbo University

Hangzhou Zewo Trading Co., Ltd

Zhejiang Xianfeng Technologies Co., Ltd.

Hangzhou Zheda Dixun Biological Gene Engineering Co., Ltd.

Hangzhou Huibo Science and Technology Co., Ltd

State Grid Corporation of China

State Grid Zhejiang Electric Power Company Limited

Zhejiang Truly Electric Co. Ltd.

Hangzhou Power Supply Company of State Grid Zhejiang Electric Power Company

State Grid Zhejiang Hangzhou Yuhang Power Supply Company

Yi Liu

Luodong Zhang

Dongming Yan

Feng Wu

Benzhong Tang

Octavian Tony Ureche

Ying Chu Wang

Niels Thomas Ferguson

Yijun Lu

Bo Yang

Vijay G Bharadwaj

Wei Lu

Mei Yu

Ling Xu

Anjun Qin

Guangping Gao

Hong Tang

Jun Song

Gaurav Sinha

Yigang Wang

Nils Dussart

Hong Zhou

Yun Ling

Lingling Jin

Iam Keong Sou

Gang Wu

Jing Zhang

Yue Xu

Zhengxiong Tian

Ying Hoi Lai

Jingzhi Sun

Guan Wang

Jiangwei Huang

Lin Yu

Shengli Fan

Rongrong Hu

Feifei Gao

Zhen Lin

Zhoujie Wu

Chunyan Zhou

Wei Lei

Minliang Zhu

Nan Zhang

Yu Zhou

Chao Qian

Shuiwang Liu

Jun Ruan

Shiwei Li

Xiaolin Meng

Guanghui Liu

Haibo Gao

Qinglin He

Jingchang Chen

Xiaoliang Guo

Junlong Gao

Li Cui

Ying Wang

Chao Xu

Lifeng Liu

Haiyan Yao

Tiyin Li

Yongwei Tu

A cyclic peptide from a bone morphogenetic protein 2 (BrvIP2). The cyclic peptide from the novel BMP2 is selected from one of the following cyclic polypeptides: 1. a cyclic polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC (SEQ ID NO:1); and 2. a cyclic polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. A preparation method for the cyclic peptide from the novel Blv1P2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.

Cyclic peptide from novel bone morphogenetic protein 2, preparation method therefor and application thereof

Packing box

Systems and methods for a hybrid system-on-chip usable for predicting performance and power requirements of a host server include a big cores module, including central processing units, for receiving and pre-processing performance and power metrics data of the host server and to allocate computing resources, a small cores module, including massively parallel processing units, for mapping each instance associated with host server in the performance and power metrics data to a corresponding massively parallel processing unit based on the allocated computing resources for a per-instance metrics calculation, and an artificial intelligence (AI) accelerator for calculating performance and power prediction results based on the per-instance calculations from the small cores module.

Hybrid system-on-chip for power and performance prediction and control

The present disclosure relates to water purification devices, and more particularly to a purification filter element and a water purification cup. The purification filter element includes a housing including a sterilization case, an activated carbon filtering section and an ion exchange resin filtering section from bottom to top. The sterilization case includes a first casing which is filled with brominated polystyrene hydantoin and a first filter screen. A gap is formed between the bottoms of the first casing and the housing. A flow limit hole is provided at the bottom of the housing. The water purification cup includes the purification filter element and a cup body. A water feed cup is detachably fastened in the cup body. A bottom of the water feed cup is connected to the housing of the purification filter element through a connection hole.

Purification filter element and water purification cup

The invention discloses an anti-corrosion coating with low through-hole ratio for steel rebars. The composition of coating includes 45-70 weight percent feldspar powder, 15-30 weight percent borax, 10-20 weight percent calcium tetraborate, 5-15 weight percent fluorspar, 4-8 weight percent clay, 1-10 weight percent adhesion agent, and 1-1.5 weight percent thickener. This invention also discloses a coating method using above-mentioned anti-corrosion coating. The method includes seven steps: 1. dry mixing, 2. wet mixing, 3. pretreatment, 4. coating, 5. baking, 6. sintering, 7. cooling down at room temperature. The coating of this invention has outstanding anti-corrosion resistance, extremely high toughness, and good durability.

Anti-corrosion coating with low through-hole ratio for steel rebars and coating method

A UV radiation detector includes: a diode including a substrate having a first side and a second side, the first side and the second side being located on opposing faces of the substrate, an active layer including rocksalt phase crystalline structure CaS disposed on the first side of the substrate, an electrical contact disposed on the second side of the substrate, and a semi-transparent conducting layer disposed on the active layer; and a circuit connecting the semi-transparent conducting layer and the electrical contact. The UV radiation detector detects radiation having a wavelength between 200 and 280 nm.

Semiconductor device and method of forming the same

This invention discloses an anti-corrosion coating sintered at low temperature for steel rebars. The composition of coating includes 30-50 weight percent nano-silica, 20-40 weight percent flux, 9-20 weight percent calcium fluoride, 2-10 weight percent thickener, and 2-14 weight percent adhesion, agent. This invention also discloses the coating method of above-mentioned anti-corrosion coating. The method includes seven steps: 1. dry mixing, 2. wet mixing, 3. pretreatment, 4. coating, 5. baking, 6. sintering, 7. cooling down at room temperature. The coating of this invention has high strength, high density, high corrosion resistance, good capacity to bond with concrete, and maintains the mechanical properties of steel rebars.

Anti-corrosion coating sintered at low temperature for steel rebars and coating method

A video window method and apparatus are provided by the present disclosure, wherein the method may include: during a video communication process, displaying video windows corresponding to at least a portion of communication participants in an associated display region on a video communication page; and upon detecting a display configuration operation with regard to an arbitrary communication participant, sending a window configuration instruction to all communication participants, causing video windows corresponding to the arbitrary communication participant to be displayed in display regions on communication devices employed by all communication participants. By technical solutions of the present disclosure, video communication pages of all communication participants of a video communication may be unilaterally managed, so that all participants may focus on a video window of a designated communication participant at the same time, facilitating improvement of interaction efficiency in video communication.

Video window display method and apparatus

A method for preparing 5-(4-bromophenyl)-4,6-dichloropyrimidine is provided. The method comprises the steps of: preparing methyl p-bromophenylacetate (Intermediate I) by catalytic esterification of p-bromophenylacetic acid, and then reacting with dimethyl carbonate to synthesize 2-(4-bromophenyl)-malonic acid-1,3-dimethyl ester (Intermediate 2), cyclizing with formamidine hydrochloride to obtain 5-(4-bromophenyl)-4,6-dihydroxypyrimidine (Intermediate 3), and then chlorinating to give the product 5-(4-bromophenyl)-4,6-dichloropyrimidine. In the process of preparing Intermediate 1 in the present invention, a solid acid is used as a catalyst. Moreover, in the process of preparing Intermediate 2, sodium methoxide is used as a base in place of sodium hydride or sodium amide used in the prior art. Furthermore, Intermediate 3 is prepared by a one-pot process.

Method for preparing 5-(4-bromophenyl)-4,6-dichloropyrimidine

A rapid autofocus method for a stereo microscope includes steps of: calculating a disparity of each of stereo microscopic images in a stereo microscopic calibration image sequence; extracting a clear stereo microscopic image sequence from the stereo microscopic calibration image sequence; then, finding out a largest disparity and a smallest disparity among the disparities of all the stereo microscopic images in the clear stereo microscopic image sequence; at a chosen magnification, arbitrarily acquiring a stereo microscopic image; finally, determining a disparity range according to the disparity of the acquired stereo microscopic image, the largest disparity and the smallest disparity, and realizing an autofocus of a target object in the acquired stereo microscopic images. The disparity range is obtained via once off-line calibration at the same magnification, and applicable to the autofocus at an arbitrary timing.

Rapid autofocus method for stereo microscope

A method of detecting the presence or absence of saccharide or saccharide level in a biological or artificial sample comprising contacting the sample with a water-soluble tetraphenylethene-cored probe having multiple functionalities of boronic acid and aggregation induced emission (AIE) characteristics, and detecting fluorescence. A method for detecting pH in a sample solution with a certain pH value comprising contacting the sample solution with a water-soluble tetraphenylethene-cored probe having multiple functionalities of boronic acid and aggregation induced emission (AIE) characteristics, and detecting fluorescence.

Specific detection of D-glucose by a tetraphenylethene-base fluorescent sensor

A key protector for a storage volume is created by generating an intermediate key and protecting, based at least in part on a public/private key pair, the intermediate key. A volume master key for encrypting and decrypting one or more volume encryption keys that are used to encrypt the storage volume can be encrypted in different manners, including being encrypted based at least in part on the intermediate key. A key protector for the storage volume is stored that includes both the encrypted volume master key and information indicating how to obtain the intermediate key. Subsequently, the key protector can be accessed and, based at least in part on a private key of the entity associated with the key protector, the intermediate key can be decrypted. The intermediate key can then be used to decrypt the volume master key.

Key protector for a storage volume using multiple keys

Glitch-free media streaming is provided by a client computing device ('client') independent of whether a remote computing device ('host') associated with media content provides real-time media content streaming services. Specifically, the client computing device (&#x201c;client&#x201d;) provides a user with real-time media content streaming services by establishing multiple connections to the host to read respective portions of the media content by sending byte-range transport protocol requests to the host. As the reading operations progress, the client evaluates transmit rates over respective ones of the connections in view of a real-time media content playback rate to regulate data flow into a streaming media buffer and provide the user with a consistent high-quality (glitch-free) streaming media presentation.

Glitch-free media streaming

Growing community of inventors

Hangzhou, China

Yi Liu