Pharis Biotec Gmbh

Other

Haemopep Pharma Gmbh

Ipf Pharmaceuticals Gmbh

Organogen Medizinisch-molekularbiologische Forschungsgesellschaft M.b.h.

Cardiorentis Ag

Pharis Biotech Gmbh

Uropep Biotech Gbr

Cardiopep Pharma Gmbh

Pharma Bissendorf Peptide Gmbh

Boehringer Mannheim Gmbh

Biovision, Ag

Neopep Pharma Gmbh. & Co.

Kabigen Ab and Skandigen Ab

Organon-medizinisch-molekularbiologische Forschungsgellschaft M.b.h

Wolf-Georg Forssmann

Ludger Ständker

Markus Meyer

Jan Münch

Frank Kirchhoff

Peter Schulz-Knappe

Knut Adermann

Veselin Mitrovic

Hans-Georg Opitz

Hartmut Luss

Klaus Dohler

Franz Herbst

Jan Munch

Ludger Standker

Gerhard Becker

Christian Stief

Hans-Dieter Zucht

Manfred Raida

Christian Georg Stief

Torsten Strohmeyer

Akmal Taher

Michael Gagelmann

Jeanette M Alt

Andreas Zgraja

Stefan Uckert

Udo Jonas

Lothar Kling

Viktor Mutt

Joachim J Schmitt

Hans Jornvall

Wolfgang Greb

Cornelia Liepke

Dieter Hock

Mats Carlquist

Alexander Krause

Erik Maronde

Hans-Jürgen Mägert

Peter Kreutzmann

Elke Rücker

Michael Schrader

Kristin Forssmann

Rudolf Richter

Michael Carsten Truss

Hossein Mostafavi

Hans-J&uuml;rgen M&auml;gert

Peter Schultz-Knappe

Bernhard Brenner

Hartmut Lüss

Volker Nier

Thomas Dschietzig

Andreas Pardigol

Klaus Döhler

Hans-Jurgen Magert

Axel Schulz

Jochen Hirsch

Michael Carsten Truβ

Franz-Josef Kramer

Silke Mark

Thomas Fl Uge

Hansueli Immer

Hans-Jürgen Magert

Christian Klessen

Catja Johansson

Peter Kreuztmann

Lars Thulin

Ludger Staendker

Jan Muench

Jan MÜNCH

Ludger STÄNDKER

Klaus-Dieter Döhler

A polypeptide having the general amino acid sequenceZIXRWXXKXPXXSZ, Z=0, Z, or pyro glutamate, wherein Zis a modification of the amino group of the N-terminal amino acid having the structure &#x2014;NRRwherein Rand/or Rare independently from each other H or an acyl, alkyl, aryl, aralkyl, cyclo alkyl and heterocyclo alkyl group; Z=0, or Z, wherein Zis a modification of the carboxyl group of the C-terminal amino acid having the structure &#x2014;C(O)&#x2014;O&#x2014;Ror &#x2014;C(O)&#x2014;NRR, wherein Ris an alkyl, aryl, aralkyl, cyclo alkyl and heterocyclo alkyl group; and Rand Rare defined as above.

Polypeptides for the treatment of diseases

A peptide effective in blocking the CXC-chemokine receptor 4 (CXCR4) mediated HIV-1 NL4-3 (X4-tropic) infection with an ICvalue of less than 50 &#x3bc;M.

Peptides with antagonistic activities against natural CXCR4

An N-terminally protected peptide having the sequence wherein X is a group protecting the N-terminal of the peptide.

Protransduzin B, a gene transfer enhancer

A process for preparing human relaxin-2 having the following amino acid sequence:  

Process for preparing human relaxin-2

The present invention relates to the use of a natriurectic peptide, such as urodilatin, for treating a patient suffering from heart failure, such as acute decompensated heart failure. Preferably, a composition comprising an effective amount of urodilatin is intravenously administered to the patient continuously through a time period of at least 24 hours and up to 120 hours, preferably at least 48 hours.

Use of natriuretic peptide for treating heart failure

A peptide having the following amino acid sequence: and its biologically active fragments and/or variants and/or derivatives, especially amidated, acetylated, sulfated, phosphorylated and/or glycosylated derivatives, and peptides obtainable by multiple synthesis which have the biological activity of ALB408-423;wherein Z represents number of from 0 to 10 amino acid residues.

CXC chemokine receptor 4 (CXCR4) antagonistic polypeptide

The present invention pertains to the use of inhibitors of phosphodiesterase I, IV and V for the prophylaxis and treatment of prostatic diseases, in particular the use of

Use of phosphordiesterase inhibitors in the treatment of prostatic diseases

Subject of the invention are peptides corresponding to a fragment of amino acids 240-290 of human prostatic acid phosphatase. The invention also relates to nucleic acids, antibodies, medicaments and diagnostics and their use and use of the peptides for the treatment and diagnosis of viral diseases, especially HIV disease.

Human semen enhancer of viral infection peptides (SEVI) and their use

The present invention relates to the use of a natriuretic peptide, urodilatin, for treating patients suffering from acute drug induced angioedema, such as ACE inhibitor related adverse events. Preferably, a composition comprising an effective amount of urodilatin is intravenously administered to the patient continuously for 18 hours to 72 hours.

Use of natriuretic peptides for treating angioedema syndromes

Use of phosphodiesterase inhibitors in the treatment of prostatic diseases

The present invention relates to the use of a peptide having the amino acid sequence NH-VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH-COOH (SEQ ID NO:) as well as variants, derivatives and fragments of the peptide for the treatment of viral diseases.

Peptides for the treatment of herpes virus infections

The invention relates to tissue inhibitor of metalloproteinase-2 (TIMP-2) as an osteoanabolically active peptide for use as a medicament for treating bone defects, bone diseases and for improving bone regeneration.

Medicament containing a tissue inhibitor of metalloproteinases-2 (TIMP-2) as an osteoanabolically active substance

Growing community of inventors

Hannover, Germany

Wolf-Georg Forssmann