Fujifilm Corporation

Japan Tissue Engineering Co., Ltd.

Tasuku Sasaki

Yoshihide Iwaki

Yuta Murakami

Rie Hando

Keita Hagiya

Masayuki Kawakami

Masayoshi Kojima

Hayato Miyoshi

Kazutaka Ogiwara

Chihaya Kakinuma

Takayuki Kobayashi

Rie Iwata

Yuichi Yoshino

Kouo Suzuki

Sanae Morioka

Makoto Ohno

Kiyohito Takada

Katsura Sugawara

Sanae Nomiyama

Kazuhiro Yamaguchi

Ken-Ichiro Hata

Eiko Goto

A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 &#x3bc;M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.

Culture method for pluripotent stem cells

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Method of culturing pluripotent stem cell, and polypeptide to be used therefor

A polypeptide composition induces a pluripotent stem cell culturing property, particularly, an excellent cell growth ability. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. The polypeptide composition includes a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, in an amount equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. A culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.

Polypeptide composition and culture method for pluripotent stem cell using same

It is an object of the present invention to provide a targeting agent, which enables the delivery of a drug to tumor sites or the imaging of tumor sites by utilizing its effect of accumulating to such tumor sites. The present invention provides a targeting agent for tumor site, which comprises a hydrophilic polymer-modified carrier coated with a gelatin-like protein that has repeats of a sequence represented by Gly-X-Y characteristic to collagen and has two or more sequences of cell adhesion signals in a single molecule wherein X and Y each independently represent an amino acid and a plurality of Gly-X-Y sequences may be the same or different.

Targeting agent for tumor site

An object of the invention is to provide type IV collagen without contamination by other proteins and without degradation or denaturation. The present invention provides a type IV collagen which is derived and extracted from lens capsules without the use of an enzyme and has a minimum molecular weight of 160 to 180 kDa measured by SDS-PAGE under reduced conditions.

Method for producing type IV collagen

Growing community of inventors

Kanagawa, Japan

Tasuku Sasaki