Covagen Ag

Sarah Batey

Dragan Grabulovski

Julian Bertschinger

Simon Brack

David Banner

Richard Woods

Ulrike Von Der Bey

Michael Hennig

Michela Silacci Melkko

Wenjuan Zha

Frédéric Mourlane

Michela Sillacci Melkko

Jörg Benz

Daniel Schlatter

Wibke Lembke

Roger Santimaria

Isabella Attinger

Nadja Banziger

Nadja Baenziger

Simon Sebastian Brack

Nadja BÄNZIGER

The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.

IL-17 binding compounds and medical uses thereof

The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)(X)(X)(X)(X)(X) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X) to (X) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.

IL-17A binding molecules and medical uses thereof

The present invention relates to a polypeptide binding to a chymase (EC 3.4.21.39), wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)A(X)(X)(X)(X)(X)LSFHKGEKFQIL(X)(X)(X)(X) (X)(X)G(X)(X)WEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X) is R, N, Q, E, K, H, S, T, C, or D; (X) is E, T, D, Q, L, P, A, S, C, M, N, E, G, A, V or I; (X) is R, T, H, N, K, S, C, N or Q; (X) is S, W, T, C, N, Q, F or Y; (X) is T, H, L, F, C, S, M, N, Q, R, K, G, A, V, I, P, Y or W; (X) is D, Q, H, E, S, T, C, N, R or K; (X) is D, N, R, E, Q, S, T, C, K or D; (X) is M, W, G, F, A, T, C, S, N, Q, Y, V, L, I or P; (X) is T, H, S, D, C, N, Q, R, K, E or absent; (X) is V, T, Q, G, A, L, I, P, S, C, M, N or absent; (X) is P, A, D, G, K, V, L, I, E, R, M, H or absent; (X) is N, V, P, I, E, T, S, A, G, L, C, M, Q or D; (X) is D, E, T, P, G, A, V, L, I, S, C, M, N or Q, and (X) is W, Y, L, G, A, V, I, P, M, or F; (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X).

Chymase binding compounds and medical uses thereof

Growing community of inventors

Zurich, Switzerland

Sarah Batey