Fujifilm Corporation

Sanae Nomiyama

Yoshihide Iwaki

Tasuku Sasaki

Rie Hando

Yuta Murakami

Keita Hagiya

Yuichi Yoshino

A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 &#x3bc;M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.

Growing community of inventors

Kanagawa, Japan

Sanae Nomiyama