Fujifilm Corporation

Rie Iwata

Kentaro Nakamura

Yoshihide Iwaki

Hiroko Inomata

Tasuku Sasaki

Yuta Murakami

Yuichi Yoshino

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Method of culturing pluripotent stem cell, and polypeptide to be used therefor

A polypeptide having an amino acid sequence in which the number of RGD sequences contained per molecular weight of 10 kDa is not less than 0.30; the number of GFPGER sequences contained per molecular weight of 10 kDa is not less than 0.15; and the number of GVMGFP sequences contained per molecular weight of 10 kDa is less than 0.30; is provided. A scaffold composition, a composition for repairing a cartilage tissue, a composition for culturing cartilage cells, and a composition for promoting glycosaminoglycan production, which compositions contain the above polypeptide, are also provided.

Polypeptide, scaffold composition, composition for cartilage tissue restoration, composition for cartilage cell culture, and composition for promoting glycosaminoglycan production

A method for selectively separating and purifying RNA from a mixture solution of nucleic acid containing DNA and RNA, wherein the method comprising the steps of: (1-a) adsorbing nucleic acid; (1-b) washing; (1-c) subjecting to a DNase treatment; (1-d) washing; and (1-e) desorbing the RNA from a nucleic acid-adsorbing porous membrane by a recovering solution, wherein in the step (1-c), a total amount of a DNase solution is 130 &#x3bc;l or less per 1 cmof the membrane. And a method for selectively separating and purifying RNA or DNA, which comprises the steps of: (2-a) adsorbing nucleic acid; (2-b) washing by a washing solution; and (2-c) desorbing the nucleic acid from a nucleic acid-adsorbing porous membrane, wherein the washing solution contains a water-soluble organic solvent having a concentration of 50% by weight or less, and does not contain a chaotropic salt.

Growing community of inventors

Kanagawa, Japan

Rie Iwata