Fujifilm Corporation

Kyoto Prefectural Public University Corporation

Rie Hando

Kentaro Nakamura

Yoshihide Iwaki

Tasuku Sasaki

Yuta Murakami

Keita Hagiya

Toshihiro Mori

Yoshihiko Makino

Hiroko Inomata

Tsukasa Kitahashi

Satoshi Gojo

Daisuke Kami

Yuichi Yoshino

Sanae Morioka

Kouo Suzuki

Sanae Nomiyama

Yumiko Takeshita

An object of the present invention is to provide an excellent treatment agent for a lysosomal storage disease. According to the present invention, there is provided a treatment agent for a lysosomal storage disease including a cell structure which includes a plurality of biocompatible polymer blocks and a plurality of cells of at least one type and in which at least one of the polymer blocks is disposed in gaps between the plurality of cells.

Treatment agent for lysosomal storage disease

A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 &#x3bc;M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.

Culture method for pluripotent stem cells

A polypeptide composition induces a pluripotent stem cell culturing property, particularly, an excellent cell growth ability. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. The polypeptide composition includes a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, in an amount equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. A culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.

Polypeptide composition and culture method for pluripotent stem cell using same

The present invention is a method for isolating and purifying a nucleic acid, where generation of foams is able to be suppressed whereby the isolation and purification of a nucleic acid are easily and efficiently carried out, the method for isolating and purifying a nucleic acid comprising the step of: (1) contacting a sample solution containing nucleic acid to a solid phase to adsorb the nucleic acid onto the solid phase; (2) contacting a washing solution to the solid phase to wash the solid phase in such a state that the nucleic acid is adsorbed; and (3) contacting an elution solution to the solid phase to desorb the nucleic acid, wherein the sample solution containing nucleic acid contains an antifoaming agent.

Method for isolating and purifying a nucleic acid

Growing community of inventors

Kanagawa, Japan

Rie Hando