Covagen Ag

Cilag International Gmbh

Patricia Henne

Dragan Grabulovski

Julian Bertschinger

Richard Woods

Isabella Attinger-Toller

Ulrike Von Der Bey

Michela Silacci Melkko

Ulrich Wüllner

Elena Kage

Irene Zbinden

Susann König-Friedrich

Barbara Zubler

Fabian Buller

The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X)(X)(X) (X)GPYWEARSL(X)TGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Yin amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.

FGFR3 binding molecules

The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)(X)(X)(X)(X)(X)D(X)SFHKGEKFQIL(X)(X)(X)(X)(X)G(X)(X)W(X)(X)RSLTTG(X)(X)G(X)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X) is A, V, I, L, M, G, P, R, H or K; (X) is S, T, N, Q, C, D or E; (X) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X) is A, V, I, L, M, G or P; (X) is F, Y, W, R, H or K; (X) is S, T, N, Q, C, F, Y or W; (X) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X) is F, Y, W, A, V, I, L, M, G or P; (X) is D, E, A, V, I, L, M, G or P; (X) is A, V, I, L, M, G or P; (X) is D, E, A, V, I, L, M, G, P, R, H or K; (X) is S, T, N, Q, C, A, V, I, L, M, G or P; (X) is F, Y, W S, T, N, Q or C; and (b) an amino acid sequence which is at least 90% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X).

Human serum albumin binding compounds and fusion proteins thereof

The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)(X)(X)(X)(X) (X)D(X)SFHKGEKFQIL(X)(X)(X)(X)(X)G(X)(X)W(X)(X)RSLTTG(X)(X)G(X)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X) is A, V, I, L, M, G, P, R, H or K; (X) is S, T, N, Q, C, D or E; (X) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X) is A, V, I, L, M, G or P; (X) is F, Y, W, R, H or K; (X) is S, T, N, Q, C, F, Y or W; (X) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X) is F, Y, W, A, V, I, L, M, G or P; (X) is D, E, A, V, I, L, M, G or P; (X) is A, V, I, L, M, G or P; (X) is D, E, A, V, I, L, M, G, P, R, H or K; (X) is S, T, N, Q, C, A, V, I, L, M, G or P; (X) is F, Y, W, S, T, N, Q or C; and (b) an amino acid sequence which is at least 90% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X).

Growing community of inventors

London, United Kingdom

Patricia Henne