Covagen Ag

Cilag International Gmbh

Michela Silacci Melkko

Dragan Grabulovski

Julian Bertschinger

Richard Woods

Patricia Henne

Elena Kage

Barbara Zubler

Simon Brack

Sarah Batey

Frédéric Mourlane

Wenjuan Zha

Nadja Baenziger

Nadja Banziger

Isabella Attinger

Roger Santimaria

Wibke Lembke

Ulrike Von Der Bey

Simon Sebastian Brack

Nadja BÄNZIGER

The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X)(X)(X) (X)GPYWEARSL(X)TGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Yin amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.

FGFR3 binding molecules

The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.

IL-17 binding compounds and medical uses thereof

Growing community of inventors

Zurich, Switzerland

Michela Silacci Melkko