Pharis Biotec Gmbh

Ipf Pharmaceuticals Gmbh

Pharis Biotech Gmbh

Relaxera Pharma Gmbh & Co. Kg I.g.

Viro Pharmaceuticals Gmbh & Co. Kg

Prof. Dr. Wolf-georg Forssmann

Relaxera Gmbh & Co. Kg I.g. C/o Immundiagnostik Ag

Ludger Ständker

Wolf-Georg Forssmann

Jan Münch

Frank Kirchhoff

Lothar Kling

Markus Meyer

Knut Adermann

Hans-Georg Opitz

Andreas Zgraja

Hossein Mostafavi

Jochen Hirsch

Elke Rücker

Franz-Josef Kramer

Peter Kreutzmann

Silke Mark

Hans-Jürgen Magert

Thomas Dschietzig

Peter Kreuztmann

Hans-Jürgen Mägert

Jan MÜNCH

A peptide effective in blocking the CXC-chemokine receptor 4 (CXCR4) mediated HIV-1 NL4-3 (X4-tropic) infection with an ICvalue of less than 50 &#x3bc;M.

Peptides with antagonistic activities against natural CXCR4

A process for preparing human relaxin-2 having the following amino acid sequence:  

Process for preparing human relaxin-2

A peptide having the following amino acid sequence: and its biologically active fragments and/or variants and/or derivatives, especially amidated, acetylated, sulfated, phosphorylated and/or glycosylated derivatives, and peptides obtainable by multiple synthesis which have the biological activity of ALB408-423;wherein Z represents number of from 0 to 10 amino acid residues.

CXC chemokine receptor 4 (CXCR4) antagonistic polypeptide

Subject of the invention are peptides corresponding to a fragment of amino acids 240-290 of human prostatic acid phosphatase. The invention also relates to nucleic acids, antibodies, medicaments and diagnostics and their use and use of the peptides for the treatment and diagnosis of viral diseases, especially HIV disease.

Human semen enhancer of viral infection peptides (SEVI) and their use

The present invention relates to the use of a peptide having the amino acid sequence NH-VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH-COOH (SEQ ID NO:) as well as variants, derivatives and fragments of the peptide for the treatment of viral diseases.

Peptides for the treatment of herpes virus infections

The invention relates to tissue inhibitor of metalloproteinase-2 (TIMP-2) as an osteoanabolically active peptide for use as a medicament for treating bone defects, bone diseases and for improving bone regeneration.

Medicament containing a tissue inhibitor of metalloproteinases-2 (TIMP-2) as an osteoanabolically active substance

A serine protease inhibitor, characterized by having a domain with four cysteines, and a sequence of 0 to 20 amino acids is present between the first and second cysteines, or the serine protease inhibitor has a domain with six cysteines, and a sequence of 7 to 20 amino acids is present between the first and second cysteines.

Serine proteinase inhibitors

A peptide having the following amino acid sequence:Z-LEAIPMSIPPEVKFNKPFVF-Z(VIRIP)and its biologically active fragments and/or variants and/or derivatives, especially amidated, acetylated, sulfated, polyethylene glycol (PEG) modified, phosphorylated and/or glycosylated derivatives, and peptides obtainable by multiple synthesis which have the biological activity of VIRIP;wherein Zand Zare independently a sequence of from 0 to 10 amino acid residues, and if Zor Z=zero amino acid residues, then Z=H and/or Z=COOH.

Peptide (VIRIP) which inhibits a circulating virus in humans and the use thereof

The invention relates to serine protease inhibitors having the amino acid sequence in accordance with Seq. ID No. 1.

A peptide referred to as cadherin-derived growth factor (CDGF) the sequence of which corresponds to a partial sequence of a pre-pro-cadherin, said pre-pro-cadherin comprising the domains signal sequence, pro sequence cadherin repeats, transmembrane region and intracellular domain, characterized in that the sequence of said peptide comprises the pro sequence, that at least one of the other domains of the pre-pro-cadherin is lacking, and that said peptide has cell-proliferative, cell-protective and/or cell-differential properties.

Growing community of inventors

Hannover, Germany

Ludger Ständker