Fujifilm Corporation

Keita Hagiya

Yoshihide Iwaki

Tasuku Sasaki

Yuta Murakami

Rie Hando

Yuichi Yoshino

Sanae Nomiyama

Sanae Morioka

Kouo Suzuki

A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 &#x3bc;M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.

Culture method for pluripotent stem cells

A polypeptide composition induces a pluripotent stem cell culturing property, particularly, an excellent cell growth ability. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. The polypeptide composition includes a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, in an amount equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. A culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.

Polypeptide composition and culture method for pluripotent stem cell using same

Growing community of inventors

Kanagawa, Japan

Keita Hagiya