Matsushita Electric Industrial Co., Ltd.

Panasonic Intellectual Property Management Co., Ltd.

Other

Keiko Yugawa

Shiro Nankai

Hiroshi Nakayama

Tadayasu Mitsumata

Toshihiko Yoshioka

Tatsurou Kawamura

Jinsei Miyazaki

Akihito Kamei

Nobuyuki Shigetoh

Nobuyuki Sigetoh

Shoji Miyazaki

Motokazu Watanabe

Hideyuki Baba

Fumihisa Kitawaki

Jin Muraoka

Seiji Takeshima

Junko Nakayama

Junko Muraoka

Junko Iwata

Jipsei Miyazaki

A method for evaluating an infection risk includes calculating a first infection risk value, which indicates a degree of an infection risk that a child is infected with an infectious disease, on the basis of infection information regarding family members, prevalence information regarding the infectious disease in organizations to which the family members belong, and one or more first infection risk coefficients, calculating, on the basis of the first infection risk value, a second infection risk value, which indicates a degree of the child's infection risk of being infected in a group at a children's facility, and performing first evaluation, in which the infection risk that the child is infected is evaluated on the basis of the first infection risk value, and second evaluation, in which the child's infection risk of being infected in the group is evaluated on the basis of the second infection risk value.

Method for evaluating infection risk, infection risk evaluation system, and medium

The present invention provides an antibody including a structural domain represented by the following amino acid sequence, in an N- to C-direction,

Antibody capable of binding to norovirus, composite, detection device and method using the same

Provided is a dimer antibody including two structural domains independently each represented by the following amino acid sequence, in an N- to C-direction,

The present invention provides a novel antibody capable of binding to a norovirus. The present invention is an antibody that consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains:N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-Cwherein

The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains:N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Antibody capable of binding to influenza virus

The immunoassay method of this invention measures the content of a subject substance in a sample. The method includes the steps of: (a) preparing a mixed solution by mixing the sample and an antibody solution including a first monoclonal antibody and a second monoclonal antibody capable of specifically binding to the subject substance; and (b) measuring an optical property of the mixed solution. The first monoclonal antibody is capable of binding to a first epitope of the subject substance, and the second monoclonal antibody is capable of binding to a second epitope of the subject substance different from the first epitope. Each of the first and second epitopes exists singly in the subject substance.

Immunoassay method/equipment, biological component measurable toilet, anti-albumin monoclonal antibody, cell strain producing the same, and albumin detection kit

According to the present invention, the expansion of measurable concentration range for an antigen in a sample solution can be achieved, without a step of dilution or the like. The concentration of an antigen contained in a sample solution is determined from the maximum value and/or minimum value of turbidity level detected in the observation of the transient phenomenon of turbidity, elapsed time when the maximum and/or minimum value is observed, and turbidity level.

Turbidimetric immunoassay and an apparatus therefor

The present invention relates to an immunoreaction measuring method for measuring an antigen or antibody contained as a subject substance in a sample, wherein the sample was mixed with at least one compound selected from the group consisting of dicarboxylic acids having a hydroxyl group, dicarboxylic acids having a double bond, straight-chain dicarboxylic acids expressed by the chemical formula (1): HOOC(CH)COOH (n is an integer), and the salts of these dicarboxylic acids, and an antibody or antigen as a specifically binding substance capable of specifically binding to the subject substance, to obtain an acidic reaction solution, and then an antigen-antibody complex, generated by an antigen-antibody reaction of the subject substance with the specifically binding substance in the reaction solution was detected. This makes it possible to improve a measurement value and to relax a limitation of a measurement range due to a zone phenomenon that occurs in an antigen-excess region.

Immunoreaction measurement method

It is intended to provide an antibody specific to HbA1c, antibody-producing cells capable of supplying the antibody in a stable state in the future, and a method of constructing the antibody-producing cells without any probability factors, and a method which comprises fusing mouse spleen cells, which have been sensitized with an immunogen composed of a compound containing the following structural formula (I) and a binding protein, with a myeloma-origin cell line, obtaining monoclonal antibody-producing cells by cloning, and then purifying and acquiring the monoclonal antibody produced by these cells into the culture supernatant 

Peptide fructose and protein conjugate with the same

The present invention provides a high-performance glucose sensor having excellent storage stability and an improved response characteristic. This sensor comprises: an electrically insulating base plate; an electrode system including at least a working electrode and a counter electrode formed on the base plate; and a reaction layer containing at least pyrrolo-quinoline quinone dependent glucose dehydrogenase, formed in contact with or in the vicinity of the electrode system, and the reaction layer contains at least one kind of additive selected from the group consisting of gluconic acid and salts thereof.

Glucose sensor

The present invention provides a high performance glucose sensor which can demonstrate high stability against preservation and produces only a low blank value. The glucose sensor comprises an electrically insulating base plate, an electrode system formed on the base plate, and a reaction layer which is formed in contact with or in the vicinity of the electrode system and contains at least a glucose dehydrogenase whose coenzyme is pyrrolo-quinoline quinone, the reaction layer further containing an additive such as phthalic acid.

A biosensor that enables rapid and simple quantitation of a substrate with high accuracy and demonstrates an excellent preservation characteristic by best retaining enzyme activity is disclosed. The biosensor comprises an electrically insulating base plate, an electrode system including at least a working electrode and a counter electrode formed on the base plate, and a reaction layer containing at least an enzyme and a sugar. The reaction layer may be formed on the electrode system. The enzyme may be selected from glucose oxidase, glucose dehydrogenase, and fructose dehydrogenase. The sugar is trehalose, sucrose, glycerol, mannitol, and ribose. If the enzyme selected is glucose dehydrogenase whose coenzyme is pyrrolo-quinoline quinone, the use of trehalose is preferable.

Biosensor containing glucose dehydrogenase

The present invention provides a sensor that electrochemically determines cholesterol in low density lipoprotein by only one feed of a sample. The sensor has: an electrode system that is mounted on an electrically insulating base plate and includes at least a working electrode and a counter electrode; an enzyme layer formed on the base plate with the electrode system; and a reagent layer that is arranged before the enzyme layer in a sample solution supply path to the electrode system. The enzyme layer includes at least an oxidoreductase and an electron mediator. The reagent layer includes a reagent that depresses reactivity of cholesterol in lipoproteins other than the low density lipoprotein with the oxidoreductase, for example, a reagent that attaches to lipoproteins other than the low density lipoprotein to form a water-soluble complex.

Cholesterol sensor and method of determining cholesterol

A method for preparing a cocaine-protein conjugate easily by using a cocaine derivative having a methoxy carbonyl group and benzoyl group. This conjugate is useful for the detection of cocaine or cocaine derivatives.

Cocaine derivative, protein conjugate thereof, monoclonal antibody producing cell line, method for preparing the cell line and monoclonal antibody

A method for preparing a cocaine-protein conjugate easily by using a cocaine derivative having a methoxy carbonyl group and benzoyl group. This conjugate is useful for the detection of cocaine or cocaine derivatives. A monoclonal antibody, a monoclonal antibody producing cell line, and a method for producing the monoclonal antibody producing cell line by using the above cocaine-protein conjugate as an immunogen is also described. The method of the invention comprises preparing a cocaine-protein conjugate with a pyridyl dithiococaine derivative of Formula (I):

Growing community of inventors

Nara, Japan

Keiko Yugawa