Panasonic Intellectual Property Management Co., Ltd.

Junko Muraoka

Jin Muraoka

Kosuke Nakajima

Shikiho Kawai

Hiroshi Nakayama

Keiko Yugawa

Provided is a method for inducing immunity of a plant using ultra fine bubble water containing a short-chain aldehyde. The plant immunity induction method according to the present disclosure comprises exposing a plant to ultra fine bubble water containing a short-chain aldehyde and an oily substance. In the ultra fine bubble water, ultra fine bubbles are dispersed in water. The life of the ultra fine bubbles in the ultra fine bubble water tends to be prolonged due to the function of the oily substance. As a result, the short-chain aldehyde is allowed to be stably present around the plant, and therefore plant immunity can be induced easily.

Plant immunity induction method and plant immunity induction agent

A scent detecting apparatus detects the amount of at least one of a scented substance or a metabolite of the scented substance released from a plant, and transmits detected-amount information indicating the detected amount of at least one of the scented substance or the metabolite to a server apparatus. The server apparatus receives the detected-amount information transmitted by the scent detecting apparatus, estimates the freshness of the plant on the basis of an added amount of the scented substance indicated by stored added-amount information and on the basis of the detected amount of at least one of the scented substance or the metabolite indicated by the received detected-amount information, and transmits freshness information regarding the estimated freshness to the scent detecting apparatus. The scent detecting apparatus receives the freshness information from the server apparatus and presents the received freshness information.

Information providing method, information providing system, scent imparting apparatus, scent detecting apparatus, and information management apparatus

A scent imparting apparatus transmits to an information management apparatus, product information that includes added-substance information indicating a first substance that is a scented substance added to a plant and production information regarding the plant. The information management apparatus stores the received product information in a production information storage unit. A scent detecting apparatus detects a second substance that is at least one of the scented substance or a metabolite of the scented substance released from a target plant, and transmits detected-substance information indicating the second substance to the information management apparatus. The information management apparatus transmits to the scent detecting apparatus, in a case where the second substance indicated by the received detected-substance information is the same as the first substance indicated by the added-substance information included in the product information stored in the production information storage unit or is the same as a metabolite of the first substance, the production information included in the product information stored in the production information storage unit. The scent detecting apparatus presents the received production information.

Providing system, scent imparting apparatus, scent detecting apparatus, and information management apparatus

The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains:N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Growing community of inventors

Kyoto, Japan

Junko Muraoka