Matsushita Electric Industrial Co., Ltd.

Daikin Industries, Ltd.

Panasonic Intellectual Property Management Co., Ltd.

Panasonic Corporation

Material Design Factory Co., Ltd.

Yugenkaisha Maruzen Byora

Other

Fujifilm Corporation

Osaka University

Yugenkaisha Shinjo Seisakusho

Air Water Inc.

Hatsuta Seisakusho Co., Ltd.

Daikin Applied Systems Co., Ltd.

Kimoto Electric Co., Ltd.

Hiroshi Nakayama

Jinsei Miyazaki

Mikiya Nakata

Keiko Yugawa

Tadayasu Mitsumata

Fumihisa Kitawaki

Naotoshi Fujita

Nobuyuki Shigetoh

Nobuyuki Shigetou

Shinichi Sakamoto

Shuji Fujimoto

Nobuki Matsui

Tatsurou Kawamura

Katsumi Shinjo

Hiroshi Doumae

Takami Arakawa

Naoki Tatehata

Akihito Kamei

Shin Higashiyama

Michisato Toyoda

Yasunori Okamoto

Masao Ogawa

Kiyoko Ooshima

Eisaku Okubo

Jin Muraoka

Hiroki Ueda

Toshiyuki Natsume

Junko Muraoka

Nobuyuki Sigetoh

Takashi Kimoto

Taturou Kawamura

Yasuhiko Oka

Mikihiko Kuroda

Hideo Tsuchida

Jipsei Miyazaki

Nobuyuki Shigeto

Takuya Hanada

Yuusuke Asada

An estimation system estimates the arrangement of objects. The estimation system includes an estimation unit. The estimation unit obtains information related to an arrangement pattern of the objects as first information and obtains, from wireless devices respectively connected to the objects, information including response times between the wireless devices as second information to estimate the arrangement of the objects based on the first information and the second information.

Estimation system and estimation method

A detection system for detecting a virus or the like. The detection system includes an autonomous collection device that is capable of moving on a floor surface and for collecting an object on the floor surface, and a station device for detecting an analyte from the object collected from the floor surface by the autonomous collection device. The autonomous collection device includes a moving part for moving on the floor surface, a primary electric blower for sucking the object on the floor surface, and a dust container for storing the sucked object. The station device includes a transfer pipe fluidically connected to the dust container of the autonomous collection device when the autonomous collection device is positioned in a home position, and a virus detection part for detecting the analyte from the object transferred from the dust container through the transfer pipe.

Detection device

A mixed solution in which a compound which forms a nonvolatile membrane at a gas-liquid interface through self-aggregation is dispersed in a volatile liquid, is ejected and atomized in a gas or in a vacuum to produce a droplet particle, and a nonvolatile membrane is then formed at the gas-liquid interface by aligning the compound on a surface of the droplet particle having a reduced diameter due to evaporation of the volatile liquid in the gas or in the vacuum to stabilize the droplet particle. The method produces a novel droplet particle which stably exists in a gas or in a vacuum without collapsing or without evaporation of the volatile liquid inside the droplet particle.

Droplet particle, and method and device for producing droplet particle

A machine learning apparatus for optimizing transfer of heat quantity is provided. A machine learning apparatus for learning at least one of a temperature and a flowrate at which a thermal transfer apparatus transfers a thermal medium in an air conditioning system including a device on a heat-providing side, a device on a heat-using side, and the thermal transfer apparatus configured to transfer the thermal medium from the device on the heat-providing side to the device on the heat-using side, the machine learning apparatus including: a state variable obtaining unit configured to obtain state variables including an operation condition of the device on the heat-providing side, an operation condition of the device on the heat-using side, and a value correlated with a heat quantity required by the device on the heat-using side; a learning unit configured to perform learning by associating the state variables with the at least one of the temperature and the flowrate; and a reward calculating unit configured to calculate a reward, based on a total value of a power consumption of the device on the heat-providing side, a power consumption of the device on the heat-using side, and a power consumption of the thermal transfer apparatus, wherein the learning unit performs learning by using the reward.

Machine learning apparatus, air conditioning system, and machine learning method

A detection system including an autonomous collection device that is capable of moving on a floor surface and for collecting an object on the floor surface, and a station device for detecting an analyte from the object collected from the floor surface by the autonomous collection device. The autonomous collection device includes a moving part for moving on the floor surface, a primary electric blower for sucking the object on the floor surface, and a dust container for storing the sucked object. The station device includes a transfer pipe fluidically connected to the dust container of the autonomous collection device when the autonomous collection device is positioned in a home position, and a virus detection part for detecting the analyte from the object transferred from the dust container through the transfer pipe.

The present disclosure provides a collection device capable of collecting a virus or the like effectively. The collection device according to the present disclosure is an autonomous collection device () for collecting an object having an analyte and moisture from a floor surface. The autonomous collection device () comprises a drying part () for drying the object, a suction opening () for suctioning the object dried by the drying part, and a dust container () for storing the object suctioned from the suction opening.

Collection device and detection device

The present disclosure provides a detection system whereby a virus or the like can be effectively detected in order to suppress the spread of infectious disease by the virus or the like. The detection system according to the present disclosure includes an autonomous collection device that is capable of moving on a floor surface and for collecting an object on the floor surface, and a station device for detecting an analyte from the object collected from the floor surface by the autonomous collection device. The autonomous collection device includes a moving part for moving on the floor surface, a primary electric blower for sucking the object on the floor surface, and a dust container for storing the sucked object. The station device includes a transfer pipe fluidically connected to the dust container of the autonomous collection device when the autonomous collection device is positioned in a home position, and a virus detection part for detecting the analyte from the object transferred from the dust container through the transfer pipe.

The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains:N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.

Antibody capable of binding to influenza virus

A heat pump system includes a heat pump circuit, a load distribution element, and a controller. The heat pump circuit includes low-stage and high-stage compression mechanisms having a fixed capacity ratio relationship. The load distribution element establishes a load distribution between first and second heat loads subjected to heating processes by heat exchange with refrigerant discharged from the low-stage and high-stage compression mechanisms, respectively. The controller performs distribution control to maintain a ratio of 1 between temperatures of the refrigerant discharged from the low-stage and high stage compression mechanisms and after heat exchange with the first and second heat loads, respectively. Alternatively, the controller performs distribution control to reduce a difference between the temperatures of the refrigerant discharged from the low-stage and high stage compression mechanisms and after heat exchange with the first and second heat loads, respectively.

Heat pump system

A dehumidification system for a dry clean room includes: a dry chamber supplied with air having a lower humidity than air in the dry clean room; a main dehumidification unit which supplies air to the dry clean room; and a terminal dehumidification unit which processes the air to be supplied from the dry clean room to the dry chamber, thus achieving energy saving and cost reduction for the dehumidification system for the dry clean room.

Dehumidification system

The present invention provides a method for manufacturing a water-repellent film, including an adhesion precursor film forming step of forming, on a substrate, an adhesion precursor film mainly of a Si&#x2014;O bond with hydrogen directly bonded to Si; an irradiating step of irradiating the adhesion precursor film with excitation energy to increase an OH group present on a surface of the adhesion precursor film to thereby change the adhesion precursor film into an adhesion reinforcing film; and an organic film coating step of coating the adhesion reinforcing film with an organic film by using a silane coupling agent, wherein a content of the hydrogen directly bonded to Si in the adhesion precursor film is 1.0&#xd7;10atoms/cmor more in terms of a Hmolecule.

Method for manufacturing water-repellent film, and substrate, nozzle plate, ink jet head, and ink jet recording device

A heat pump system includes a heat pump circuit, a heat load circuit, first and second heat exchangers, a flow rate regulation mechanism and a controller. A first passage connects branching and converging portions of the heat load circuit. A second passage connects the branching and converging portions without converging with the first passage. The first and second heat exchanger perform heat exchange between discharge refrigerant from the low and high stage compression mechanisms and fluid in the first and second passages, respectively. The flow rate regulation mechanism regulates a ratio between flow rates through the first and second passages. The controller controls the flow rate regulation mechanism so that the fluid is allowed to flow to the first heat exchanger when a temperature of refrigerant flowing into the first heat exchanger is lower than a heating target temperature of converged fluid flowing through the heat load circuit.

A gas barrier film in which a gas barrier layer deposited by catalyst CVD in contact with each of both main surfaces of a plastic film is an SiCNFH layer satisfying conditions of 0.01&#x3c;I(SiH)/I(SiN)&#x3c;0.05, 0.00&#x3c;I(CH)/I(SiN)&#x3c;0.07, 0.04&#x3c;I(NH)/I(SiN)&#x3c;0.08, and 0.05&#x3c;I(CF)/I(SiN)&#x3c;0.3; an SiOCNH layer satisfying conditions of 0.1&#x3c;I(SiH)/I(NH)&#x3c;0.9, 0.0&#x3c;I(CH)/I(NH)&#x3c;0.3, 8&#x3c;I(SiN)/I(NH)&#x3c;20, and 2&#x3c;I(SiO)/I(NH)&#x3c;8; or an SiCNH layer satisfying conditions of 0.01&#x3c;I(SiH)/I(SiN)&#x3c;0.05, 0.00&#x3c;I(CH)/I(SiN)&#x3c;0.07 and 0.04&#x3c;I(NH)/I(SiN)&#x3c;0.08. Here, the 'I' represents peak intensity of Fourier transform infrared spectroscopy related to an atomic bond shown in the parentheses after the 'I'.

Gas barrier film, electronic device including the same, gas barrier bag, and method for producing gas barrier film

Disclosed is a fire extinguisher () comprising a fire extinguisher cylinder () for a fire-extinguishing agent. The fire extinguisher cylinder () comprises a mouth portion as an opening, a shoulder, a cylindrical body portion, and a bottom portion and is shaped with use of a resin provided with no joint. In addition, the body portion in the fire extinguisher cylinder () has a thickness from 1 mm to 5 mm, and a crystallinity of the resin is from 13% to 30% at the sites other than the mouth portion and the bottom portion. Accordingly, the fire extinguisher () is lightweight and does not rust. Further, the fire extinguisher () has high strength or high pressure resistance.

Fire extinguisher, fire extinguisher cylinder, and preform of fire extinguisher cylinder

An input device for constructing an inputting operation unit for various electronic apparatus and a method of manufacturing the input device are provided. The input device allows push-down inputting operation and position inputting operation using the same operating unit. The input device has a position input sensor provided under a key, and a base sheet having a movable contact joined to its bottom face depending on the location where the key is disposed, and a columnar section is disposed in a manner sandwiched between the position input sensor and the base sheet at the center of the movable contact.

Input device and manufacturing method thereof

Growing community of inventors

Osaka, Japan

Hiroshi Nakayama