The University of Queensland

Cbio Limited

Halle Morton

Alice Christina Cavanagh

Geoffrey R Hill

Tatjana Banovic

The invention is directed to the use of cpn10 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.

Chaperonin 10 immunosuppression

The invention is directed to the use of cpnl0 in transplantation and particularly to treatment and/or prevention of graft versus host disease. The invention provides a method of administration of cpn10 to a donor and/or recipient animal or cells, tissues or organs derived from the donor, although in a particularly advantageous form treatment of both the donor and recipient animal. The method may further include the administration to the donor and/or recipient animal at least one other immunosuppressive agent to prevent or alleviate graft versus host disease.

Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSMAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQ ATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDIL GKYVD (SEQ ID NO:). Antibodies are raised against either the entire sequence of cpnor a shorter peptide sequence derived from cpnsuch as Ac-AGQAFRKFLPL (SEQ ID NO:), ACQAFRKFLPL (SEQ ID NO), or EKSQGKVLQAT (SEQ ID NO:), in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.

Antagonists to chaperonin 10

Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD. Antibodies are raised against either the entire sequence of cpn10, or a shorter peptide sequence derived from cpn10, such as Ac-AGQAFRKLPI.,AGQAFRKFI.PI., or EKSQGKVLQAT, in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system.

A process for the detection of cpn10 in serum or other biological fluids including the steps of (i) raising antibody to cpn10; (ii) reacting said antibody with a sample of biological fluid suspected of containing cpn10; and (iii) detecting the presence of cpn10 in said sample by a signal amplification resulting from production of a cpn10-antibody complex. There is also provided a process for promotion of cell growth or immunosuppression including the step of administration of cpn10 to a mammalian subject. There is also provided recombinant cpn10.

Method for promoting cell growth and immunosuppression using chaperonin

An antagonist to, or an antibody (Ab) raised against, cpn10 or a recombinant cpn10 with the sequence: GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD is claimed. Also, claimed are: (1) an antagonist or Ab raised against a peptide derived from cpn10, or a peptide with the sequence: Ac-AGQAFRKLPL(C) AGQAFRKFLPLA2 A1AGQAFRKFLPL Ac-A1AGQAFRKFLPL (A1)EKSQGKVLQATA2 A1EKSQGKVLQAT where A1 and A2 are amino acid sequences that may be added to one or both ends of the peptides, and where the peptides may have a single amino acid deletion, addition or substitution; (2) suppressing cellular growth or enhancing immunological activity by admin. of a cpn10 antagonist or anti-cpn10 Ab to a subject; and (3) an assay for measuring anti-cpn10 Ab in a sample by: (a) reacting purified cpn10 with the sample (b) determining the amt. of Ab in the sample by determining the binding between the Ab and cpn10. USE--The cpn 10 antagonist or Ab can be used to terminate pregnancy, suppressing tumour cell growth or enhancing the immune system.

Growing community of inventors

Coorparoo, Australia

Halle Morton