Ipf Pharmaceuticals Gmbh

Other

Pharis Biotec Gmbh

Pharis Biotech Gmbh

Viro Pharmaceuticals Gmbh & Co. Kg

Frank Kirchhoff

Thorsten Siess

Wolf-Georg Forssmann

Scott C Corbett

Glen Robert Fantuzzi

Jan Münch

Ludger Ständker

Knut Adermann

Maral Yolamanova

Elke Rücker

Axel Schulz

Jan Munch

Ludger Standker

John Murphy

Jan MÜNCH

Ludger STÄNDKER

A peptide effective in blocking the CXC-chemokine receptor 4 (CXCR4) mediated HIV-1 NL4-3 (X4-tropic) infection with an ICvalue of less than 50 &#x3bc;M.

Peptides with antagonistic activities against natural CXCR4

A peptide having the following amino acid sequence: and its biologically active fragments and/or variants and/or derivatives, especially amidated, acetylated, sulfated, phosphorylated and/or glycosylated derivatives, and peptides obtainable by multiple synthesis which have the biological activity of ALB408-423;wherein Z represents number of from 0 to 10 amino acid residues.

CXC chemokine receptor 4 (CXCR4) antagonistic polypeptide

The invention relates to a peptide derived from HIV-1 gp120 which forms insoluble aggregates when introduced into an aqueous solution and its use for enhancing viral infection of cells. In addition, the invention comprises methods for enhancing viral infection of cells, for concentrating a virus and for separating a virus from a fluid.

Viral infection enhancing peptide

Subject of the invention are peptides corresponding to a fragment of amino acids 240-290 of human prostatic acid phosphatase. The invention also relates to nucleic acids, antibodies, medicaments and diagnostics and their use and use of the peptides for the treatment and diagnosis of viral diseases, especially HIV disease.

Human semen enhancer of viral infection peptides (SEVI) and their use

The present invention relates to the use of a peptide having the amino acid sequence NH-VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH-COOH (SEQ ID NO:) as well as variants, derivatives and fragments of the peptide for the treatment of viral diseases.

Peptides for the treatment of herpes virus infections

The invention relates to peptides with biological activity against infection having the amino acid sequence Z-LE-X-IP-X-X-X-P-X-X-X-X-X-X-K-X-X-X-X-X-Z, wherein Xis a lysine, alanine, or aspartic acid; Xis a cysteine, methionine or isoleucine; Xis a serine, cysteine, lysine or glycine; Xis an isoleucine, alanine, phenylalanine or cysteine; Xis a proline, D-proline or a substituted L- or D-proline; Xis a cysteine or glutamic acid; Xis an amino acid with a hydrophobic or an aromatic side chain or cysteine; Xis an amino acid with a hydrophobic or an aromatic side chain or cysteine; Xis an amino acid with an aromatic side chain; Xis a glycine, alanine or asparagine; Xis a proline, aspartic acid, octahydroindolyl-2-carboxylic acid or D-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid; Xis a phenylalanine, alanine, glycine, glutamic acid or D-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid; Xis an amino acid with a hydrophobic or an aromatic side chain; Xis an amino acid with a hydrophobic or an aromatic side chain; Xis a phenylalanine or deletion; Zis NHor a sequence of 1 to 10 amino acid residues; Zis COOH or a sequence of 1 to 10 amino acid residues; and peptides which are fragments and/or covalently linked oligomers and/or derivatives, especially amidated, alkylated, acylated, sulfated, pegylated, phosphorylated and/or glycosylated derivatives, and mutants thereof, and with the provisio that (a) if Xis alanine, glycine, glutamic acid, or D-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid than X, Xand Xare phenylalanine, valine and phenylalanine respectively; and/or (b) if Xis phenylalanine, than X, Xand Xare valine, phenylalanine and a deletion, respectively; and (c) that there are at maximum two cysteine residues in a peptide.

Peptides and their use for the treatment of HIV infections

A peptide having the following amino acid sequence:Z-LEAIPMSIPPEVKFNKPFVF-Z(VIRIP)and its biologically active fragments and/or variants and/or derivatives, especially amidated, acetylated, sulfated, polyethylene glycol (PEG) modified, phosphorylated and/or glycosylated derivatives, and peptides obtainable by multiple synthesis which have the biological activity of VIRIP;wherein Zand Zare independently a sequence of from 0 to 10 amino acid residues, and if Zor Z=zero amino acid residues, then Z=H and/or Z=COOH.

Peptide (VIRIP) which inhibits a circulating virus in humans and the use thereof

Growing community of inventors

Ulm, Germany

Frank Kirchhoff