Akzo Nobel N.v.

Akzo N.v.

N.v. Organon

Ebo S Bos

Michael G Hanna, Jr

Nicholas Pomato

Martin V Haspel

Constant Adriaan Anton Van Boeckel

Martin De Kort

Janet H Ransom

Michael L Berman

Petrus J Boon

Franciscus M Kaspersen

Gijsbertus Franciscus Verheijden

Anna Maria Boots

Meertinus Jan Smit

The present invention relates to conjugates of a polypeptide and an oligosaccharide, wherein the polypeptide is conjugated to at least one oligosaccharide-spacer residue, the oligosaccharide being a synthetic sulfated oligosaccharide comprising 4-18 monosaccharide units and per se having affinity to antithrombin III and the spacer being a bond or an essentially pharmacologically inactive flexible linking residue, or a pharmaceutically acceptable salt thereof. The conjugates of the invention have improved pharmacokinetic properties when compared to the original polypeptides (i.e. the corresponding non-conjugated polypeptides per se).

Conjugates of a polypeptide and a pentasaccharide

The present invention relates to novel peptides derived from the autoantigen HC gp-39, said peptides comprising at least one of the amino acid sequences FGRSFTILAS (SEQ ID No. 1), FTLASSETG (SEQ ID No. 2), YDDQESVKS (SEQ ID No. 3) and FSKIASNTQ (SEQ ID No. 4). The peptides resemble MHC Class II restricted T-cell epitopes present on the autoantigen HC gp-39 in articular cartilage. HC gp-39, proteins comprising an amino acid sequence which exhibits at least 50% homology with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISND (SEQ ID No: 10) and said peptides can be used in antigen-specific treatment of articular cartilage destruction in autoimmune diseases in mammals to induce systemic tolerance of the immune system. The autoantigen HC gp-39, proteins comprising an amino acid sequence which exhibits at least 50% homology with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISND (SEQ ID NO: 10) and said peptides are also suitable to induce arthritis in animals, preferably mice. The invention furthermore relates to pharmaceutical compositions comprising said autoantigen and/or said peptides, a diagnostic method for the detection of autoreactive T cells in a test sample and test kits to be used in said method.

Proteins and novel peptides derived from autoantigen for use in

The present invention comprises the epitope recognized by the human monoclonal antibody 28A32, the human tumor antigen containing this epitope, which we have identified, isolated and characterized, and human MCA 28A32. The invention also relates to the use of antibodies to the antigen containing this epitope for diagnosis and monitoring of treatment of cancer and to the use of this antigen in the preparation of vaccines to elicit an immune response similar to that obtained against tumor cells containing this epitope.

CTAA 28A32, the antigen recognized by MCA 28A32

The present invention comprises the epitope recognized by the human monoclonal antibody 16-18, the human tumor antigen containing this epitope, which we have identified, isolated and characterized, and anti-idiotypic antibodies to human MCA 16-88, which comprise the same epitope. The invention also relates to the use of antibodies to the antigen containing this epitope for diagnosis and monitoring of treatment of cancer and to the use of this antigen in the preparation of vaccines to elicit an immune response similar to that obtained against tumor cells containing this epitope.

Antigen recognized by MCA 16-88

This invention relates to the field of immune therapy of cancer, more specifically to immunoconjugates of a cytotoxic moiety with a targeting moiety, more specifically to immunoconjugates of antibodies or fragments or functional derivatives of antibodies coupled to a cytotoxic substance such as drugs, toxins or radioisotopes. It especially relates to the release of substances bound to a targeting moiety through the use of acid-cleavable linker molecules.

Acid-labile linker molecules

Growing community of inventors

Oss, Netherlands

Ebo S Bos