Covagen Ag

Eidgenoessische Technische Hochschule Zurich

Cilag International Gmbh

Mitsubishi Tanabe Pharma Corporation

Dragan Grabulovski

Julian Bertschinger

Richard Woods

Dario Neri

Patricia Henne

Ulrike Von Der Bey

Simon Brack

Michela Silacci Melkko

Isabella Attinger-Toller

Sarah Batey

Wenjuan Zha

Ulrich Wüllner

Frédéric Mourlane

Irene Zbinden

Elena Kage

Fabian Buller

Susann König-Friedrich

Barbara Zubler

David Banner

Roland A Newman

Michael Hennig

Steve Granger

Michela Silacci

Daniel Schlatter

Jörg Benz

Isabella Toller

Babette Schade

Kristina Klupsch

Helen Hachemi

Nadja Baenziger

Michela Sillacci Melkko

Nadja Banziger

Isabella Attinger

Roger Santimaria

Michael Lyman

Wibke Lembke

Susann KÖNIG-Friedrich

Simon Sebastian Brack

Ulrich WÜLLNER

Nadja BÄNZIGER

The present invention relates to a polypeptide binding to fibroblast growth factor receptor 3 isoforms 3b and 3c (FGFR3b and FGFR3c), wherein the polypeptide comprises an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDYEVYGPTPMLSFHKGEKFQIL(X)(X)(X) (X)GPYWEARSL(X)TGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X) may be any amino acid sequence; (b) an amino acid sequence which is at least 95% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X) and provided that the amino acid sequence EVYGPTPM (SEQ ID NO: 2) in amino acid positions 12 to 19 of SEQ ID NO: 1 is conserved and the amino acids P and Y in amino acid positions 37 and 38 of SEQ ID NO: 1 are conserved; (c) GVTLFVALYDYEVMSTTALSFHKGEKF QILSQSPHGQYWEARSLTTGETG(X)IPSNYVAPVDSIQ (SEQ ID NO: 19), wherein the amino acid position (X) may be any amino acid; and (d) an amino acid sequence which is at least 95% identical to the amino acid sequence of (c), wherein the identity determination excludes amino acid position (X) and provided that the amino acid sequences EVMSTTA (SEQ ID NO: 20) in amino acid positions 12 to 18 of SEQ ID NO: 19 and SQSPH (SEQ ID NO: 21) in amino acid positions 31 to 35 of SEQ ID NO: 19 are conserved and the amino acids Q and Yin amino acid positions 37 and 38 of SEQ ID NO: 19 are conserved.

FGFR3 binding molecules

A library is provided having a plurality of recombinant derivatives of the SH3 domain of the Fyn kinase of SEQ ID NO: 1, where one or more of the derivatives have a specific binding affinity to a protein or peptide that is not a natural SH3 binding ligand. Substantially each of the derivatives of the SH3 domain of the Fyn kinase of SEQ ID NO: 1 has an amino acid sequence with at least 80% sequence identity to the amino acid sequence of SEQ ID NO: 1, and at least 90% identity to the amino acid of SEQ ID NO: 1 outside the src and RT loops. Additionally, the amino acid sequence has at least one amino acid in or positioned up to two amino acids adjacent to the RT loop or the src loop of SEQ ID NO: 1 which is substituted, deleted or added.

Specific and high affinity binding proteins comprising modified SH3 domains of FYN kinase

The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)(X)(X)(X)(X)(X)D(X)SFHKGEKFQIL(X)(X)(X)(X)(X)G(X)(X)W(X)(X)RSLTTG(X)(X)G(X)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X) is A, V, I, L, M, G, P, R, H or K; (X) is S, T, N, Q, C, D or E; (X) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X) is A, V, I, L, M, G or P; (X) is F, Y, W, R, H or K; (X) is S, T, N, Q, C, F, Y or W; (X) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X) is F, Y, W, A, V, I, L, M, G or P; (X) is D, E, A, V, I, L, M, G or P; (X) is A, V, I, L, M, G or P; (X) is D, E, A, V, I, L, M, G, P, R, H or K; (X) is S, T, N, Q, C, A, V, I, L, M, G or P; (X) is F, Y, W S, T, N, Q or C; and (b) an amino acid sequence which is at least 90% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X).

Human serum albumin binding compounds and fusion proteins thereof

Provided is a bi-specific fusion polypeptide comprising a fynomer sequence that binds to interleukin-17a (IL-17a) and is conjugated to an antibody or subsequence thereof that binds to interleukin-6 receptor (IL-6R). The fusion polypeptide can bind to both IL-17a and IL-6R thereby suppresses, reduces, decreases, inhibits or blocks both IL-17a and IL-6R activities.

Antibody-fynomer conjugates

The present invention relates to a method for the production of a library comprising recombinant derivatives of the SH3 domain of the Fyn kinase of SEQ ID NO: 1 as well as a method for selecting from a library comprising recombinant derivatives of the SH3 domain of the Fyn kinase of SEQ ID NO: 1 one or more of said derivatives having a specific binding affinity to a protein or peptide.

The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)(X)(X)(X)(X) (X)D(X)SFHKGEKFQIL(X)(X)(X)(X)(X)G(X)(X)W(X)(X)RSLTTG(X)(X)G(X)IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X) is A, V, I, L, M, G, P, R, H or K; (X) is S, T, N, Q, C, D or E; (X) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X) is A, V, I, L, M, G or P; (X) is F, Y, W, R, H or K; (X) is S, T, N, Q, C, F, Y or W; (X) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X) is F, Y, W, A, V, I, L, M, G or P; (X) is D, E, A, V, I, L, M, G or P; (X) is A, V, I, L, M, G or P; (X) is D, E, A, V, I, L, M, G, P, R, H or K; (X) is S, T, N, Q, C, A, V, I, L, M, G or P; (X) is F, Y, W, S, T, N, Q or C; and (b) an amino acid sequence which is at least 90% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X).

Specific and high affinity binding proteins comprising modified SH3 domains of Fyn kinase

The present invention relates to a binding molecule that specifically binds to two different epitopes of an antigen expressed on tumor cells, wherein the binding molecule comprises: (a) a first binding (poly)peptide that specifically binds to a first epitope of said antigen expressed on tumor cells, wherein said first binding (poly)peptide is a Fyn SH3-derived polypeptide; and (b) a second binding (poly)peptide that specifically binds to a second epitope of said antigen expressed on tumor cells. The present invention further relates to a nucleic acid molecule encoding the binding molecule of the invention, a vector comprising said nucleic acid molecule as well as a host cell or a non-human host transformed with said vector. The invention further relates to a method of producing a binding molecule of the invention as well as to pharmaceutical and diagnostic composition. Moreover, the present invention also relates to the binding molecule, the nucleic acid molecule, the vector or the host cell of the invention for use in the treatment of tumors.

Binding molecules with antitumoral activity

The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.

IL-17 binding compounds and medical uses thereof

The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)(X)(X)(X)(X)(X) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X) to (X) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.

IL-17A binding molecules and medical uses thereof

The present invention relates to a polypeptide binding to a chymase (EC 3.4.21.39), wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X)A(X)(X)(X)(X)(X)LSFHKGEKFQIL(X)(X)(X)(X) (X)(X)G(X)(X)WEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X) is R, N, Q, E, K, H, S, T, C, or D; (X) is E, T, D, Q, L, P, A, S, C, M, N, E, G, A, V or I; (X) is R, T, H, N, K, S, C, N or Q; (X) is S, W, T, C, N, Q, F or Y; (X) is T, H, L, F, C, S, M, N, Q, R, K, G, A, V, I, P, Y or W; (X) is D, Q, H, E, S, T, C, N, R or K; (X) is D, N, R, E, Q, S, T, C, K or D; (X) is M, W, G, F, A, T, C, S, N, Q, Y, V, L, I or P; (X) is T, H, S, D, C, N, Q, R, K, E or absent; (X) is V, T, Q, G, A, L, I, P, S, C, M, N or absent; (X) is P, A, D, G, K, V, L, I, E, R, M, H or absent; (X) is N, V, P, I, E, T, S, A, G, L, C, M, Q or D; (X) is D, E, T, P, G, A, V, L, I, S, C, M, N or Q, and (X) is W, Y, L, G, A, V, I, P, M, or F; (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X) to (X).

Chymase binding compounds and medical uses thereof

Growing community of inventors

Zurich, Switzerland

Dragan Grabulovski