Gropep Limited

Gropep Pty, Ltd.

Novozymes Biopharma Au Limited

David Andrew Belford

Francis John Ballard

Geoffrey Leonard Francis

Geoffrey Owen Regester

Leanna Christine Read

Allison June Cowin

Timothy Edward Rayner

Christopher Goddard

Andrew Jeremy Dunbar

Geoffrey Welsford Smithers

Mary-Louise Rogers

This invention relates to a method for treating skin damage, comprising the step of administration of a pharmaceutical or dermatological composition of basic milk factors to the area of the skin of a subject in need of such treatment. The invention further relates to a method for cosmetically treating the aged appearance of skin. The skin damage may be the result of normal biological ageing, environmental factors, dermatological disorders, medical treatments, surgical treatments and/or medical conditions. The aged appearance of skin may be attributed to wrinkles, blemishes, sagging, hyperpigmentation, changes to skin thickness and/or a rough appearance. In a preferred embodiment, the subject in need of such treatment requires the enhancement of the youthful appearance of their skin. The invention further relates to compositions for the treated of these conditions.

Method for treating damage in intact skin comprising administering a composition comprising basic milk growth factors in amounts higher than those in milk

The invention relates to pharmaceutical or veterinary compositions for the treatment of surface wounds; pharmaceutical or veterinary compositions for the treatment of gastrointestinal injuries, diseases or ulcers; methods of treating surface wounds in animals, including humans; and methods for the treatment of gastrointestinal injuries, diseases or ulcers which compositions and methods include compositions of milk product extracts including growth factors with basic to approximately neutral isoelectric points.

Growth-promoting agent

A mammalian milk growth factor (MMGF) having the following amino acid sequence or substantially homologous sequence: DGNSTRSPEDDGLLCGDHAENCPATTTQPKRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFY (SEQ ID NO:2) or a mutant, analogue, derivative or functionally active fragment thereof.

Mammalian milk growth factor

The invention provides a process for preparing a plurality of modified milk growth factors which process includes: providing a milk product extract including a plurality of milk growth factors having basic to approximately neutral isoelectric points and a source of acid; subjecting the milk product extract to transient acidification utilising the acid source; and isolating a plurality of modified milk growth factors from the transiently acidified milk product extract. Also provided are growth promoting compositions, cell culture compositions, and pharmaceutical or veterinary compositions for the treatment of surface wounds, gastrointestinal injuries, diseases or ulcers, each including a plurality of modified milk growth factors having isoelectric points above approximately 6.0 and molecular weights in the range of approximately 5000 to 30.000, the milk growth factors being modified by transient acidification.

Modified milk growth factor

Growing community of inventors

Seacliff Park, Australia

David Andrew Belford